JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158769

Recombinant Human Integrin alpha 6 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Integrin alpha 6 protein is a Human Fragment protein, in the 24 to 133 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

CD49f, Integrin alpha-6, CD49 antigen-like family member F, VLA-6, ITGA6

1 Images
SDS-PAGE - Recombinant Human Integrin alpha 6 protein (AB158769)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Integrin alpha 6 protein (AB158769)

ab158769 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P23229

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":133,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P23229","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Integrin alpha 6 also known as ITGA6 or CD49f functions as a transmembrane receptor protein involved in cell adhesion and signal transduction. As part of the broader integrin family integrin alpha 6 typically pairs with the beta 1 or beta 4 subunits forming the alpha6beta1 or alpha6beta4 integrins respectively. It has a molecular mass of approximately 150 kDa. This protein is mainly expressed in epithelial cells but also found in platelets certain immune cells and in the nervous system. Its expression patterns highlight its role in a variety of cellular and tissue functions.
Biological function summary

The integrin alpha 6 protein partners with the beta 4 subunit to form a heterodimer complex that plays an important role in cellular adhesion to the extracellular matrix specifically interacting with laminins. Its main action helps cells attach to the basement membrane which is an important component of epithelial tissue structure and integrity. The alpha 6 integrin provides structural cell support and participates in transmitting signals that influence cell behavior such as movement survival and proliferation.

Pathways

Integrins including the alpha 6 variant are important components in the integrin signaling pathway and are involved in cell motility and survival pathways. In particular the alpha 6 integrin partners with proteins like focal adhesion kinase (FAK) and phosphoinositide 3-kinase (PI3K) to initiate downstream signaling cascades. The interaction with laminins activates pathways critical for developmental processes and tissue remodeling highlighting their role in maintaining cellular environments.

Integrin alpha 6 has significant implications in cancer progression and skin blistering disorders. In various cancers such as breast and skin cancers upregulation of integrin alpha 6 promotes tumor growth and metastasis through interaction with proteins like collagen and laminins found in the tumor microenvironment. Furthermore in the context of blistering disorders such as epidermolysis bullosa mutations in the beta 4 subunit that pairs with alpha 6 can disrupt the integrity of epithelial tissues leading to severe impact on the skin’s structural stability.

Specifications

Form

Liquid

General info

Function

Integrin alpha-6/beta-1 (ITGA6 : ITGB1) is a receptor for laminin on platelets (By similarity). Integrin alpha-6/beta-1 (ITGA6 : ITGB1) is present in oocytes and is involved in sperm-egg fusion (By similarity). Integrin alpha-6/beta-4 (ITGA6 : ITGB4) is a receptor for laminin in epithelial cells and it plays a critical structural role in the hemidesmosome (By similarity). ITGA6 : ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed : 20682778). ITGA6 : ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed : 22351760). ITGA6 : ITGB4 binds to IGF2 and this binding is essential for IGF2 signaling (PubMed : 28873464).

Sequence similarities

Belongs to the integrin alpha chain family.

Post-translational modifications

Isoforms containing segment A, but not segment B, are the major targets for PMA-induced phosphorylation. Phosphorylation occurs on 'Ser-1103' of isoform alpha-6X1X2A. Phosphorylation is not required for the induction of integrin alpha-6A/beta-1 high affinity but may reduce the affinity for ligand.. Undergoes PLAU-mediated cleavage at residues Arg-634-635-Arg in a time-dependent manner to produce processed integrin alpha-6 (alpha6p) (PubMed:11359780, PubMed:15023541, PubMed:17303120). Production of alpha6p enhances prostate cancer cell invasion and migration (PubMed:17303120).. Palmitoylation by DHHC3 enhances stability and cell surface expression.

Product protocols

Target data

Integrin alpha-6/beta-1 (ITGA6 : ITGB1) is a receptor for laminin on platelets (By similarity). Integrin alpha-6/beta-1 (ITGA6 : ITGB1) is present in oocytes and is involved in sperm-egg fusion (By similarity). Integrin alpha-6/beta-4 (ITGA6 : ITGB4) is a receptor for laminin in epithelial cells and it plays a critical structural role in the hemidesmosome (By similarity). ITGA6 : ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed : 20682778). ITGA6 : ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed : 22351760). ITGA6 : ITGB4 binds to IGF2 and this binding is essential for IGF2 signaling (PubMed : 28873464).
See full target information ITGA6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com