JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB71475

Recombinant human Interferon beta protein (Active)

Be the first to review this product! Submit a review

|

(7 Publications)

Recombinant human Interferon beta protein (Active) is a Human Full Length protein, in the 22 to 187 aa range, expressed in CHO cells, with >95%, < 1 EU/µg endotoxin level, suitable for FuncS, HPLC, SDS-PAGE.

View Alternative Names

IFB, IFNB, IFNB1, Interferon beta, IFN-beta, Fibroblast interferon

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

CHO cells

Tags

Tag free

Applications

HPLC, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Determined by a cytotoxicity assay using human TF-1 cells. The expected ED50 is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1 x 107 units/mg.

Accession

P01574

Animal free

No

Carrier free

No

Species

Human

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Due to glycosylation ab71475 has an approximate MW of 22.3 kDa based on SDS-PAGE gel and Mass Spectrometry.</p>" } } }

Sequence info

[{"sequence":"MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN","proteinLength":"Full Length","predictedMolecularWeight":"20 kDa","actualMolecularWeight":null,"aminoAcidEnd":187,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"CHO cells","accessionNumber":"P01574","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Interferon beta also known as IFN-beta or beta interferon is a type I interferon with a mass of approximately 20 kDa. It originates primarily from fibroblasts and plays an essential role in the immune response. This protein targets and binds to specific cell surface receptors initiating various antiviral states within cells. This action assists in slowing down viral replication and spread. IFN-beta's expression increases in response to viral infections making it an important component in the body's first line of defense against pathogens.
Biological function summary

Interferon beta functions as an important mediator of immune functions regulating the activity of natural killer cells and macrophages. It also boosts antigen presentation to T cells. Interferon beta belongs to the larger family of interferons which includes IFN-alpha and IFN-gamma each having distinct effects but working together to mount an effective immune response. Though it does not form part of a complex it plays a critical standalone role in immune signaling pathways.

Pathways

Interferon beta associates strongly with the JAK-STAT signaling pathway. Upon activation it interacts with receptors to phosphorylate STAT proteins mainly STAT1 and STAT2 which then dimerize and translocate to the nucleus to trigger gene expression. Another important pathway is the antiviral response where interferon beta modulates the expression of hundreds of interferon-stimulated genes. These pathways intricately involve other proteins like IFN-alpha and IFN-gamma which work synergistically to establish an effective antiviral environment.

Interferon beta shows significant implications in multiple sclerosis and hepatitis C infection. It is widely used as a therapeutic agent in managing multiple sclerosis by modulating the immune response to reduce inflammation and slow disease progression. Similarly its role in antiviral defense makes it relevant to hepatitis C infection management. In these contexts IFN-alpha and IFN-gamma are also important as they share similar antiviral and immunomodulatory functions that can complement IFN-beta's actions enhancing the treatment's efficacy.

Specifications

Form

Lyophilized

Additional notes

>= 95% HPLC analyses. Due to glycosylation, IFN-Β has an approximate MW of 22.3 kDa based on SDS-PAGE gel

General info

Function

Type I interferon cytokine that plays a key role in the innate immune response to infection, developing tumors and other inflammatory stimuli (PubMed : 10049744, PubMed : 10556041, PubMed : 6157094, PubMed : 6171735, PubMed : 7665574, PubMed : 8027027, PubMed : 8969169). Signals via binding to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptor, activating the canonical Jak-STAT signaling pathway resulting in transcriptional activation or repression of interferon-regulated genes that encode the effectors of the interferon response, such as antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins (PubMed : 10049744, PubMed : 10556041, PubMed : 7665574, PubMed : 8027027, PubMed : 8969169). Signals mostly via binding to a IFNAR1-IFNAR2 heterodimeric receptor, but can also function with IFNAR1 alone and independently of Jak-STAT pathways (By similarity). Elicits a wide variety of responses, including antiviral and antibacterial activities, and can regulate the development of B-cells, myelopoiesis and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor (By similarity). Plays a role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons : acts by promoting neuronal autophagy and alpha-synuclein clearance, thereby preventing dopaminergic neuron loss (By similarity). IFNB1 is more potent than interferon-alpha (IFN-alpha) in inducing the apoptotic and antiproliferative pathways required for control of tumor cell growth (By similarity).

Sequence similarities

Belongs to the type-I (or alpha/beta) interferon family.

Product protocols

Target data

Type I interferon cytokine that plays a key role in the innate immune response to infection, developing tumors and other inflammatory stimuli (PubMed : 10049744, PubMed : 10556041, PubMed : 6157094, PubMed : 6171735, PubMed : 7665574, PubMed : 8027027, PubMed : 8969169). Signals via binding to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptor, activating the canonical Jak-STAT signaling pathway resulting in transcriptional activation or repression of interferon-regulated genes that encode the effectors of the interferon response, such as antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins (PubMed : 10049744, PubMed : 10556041, PubMed : 7665574, PubMed : 8027027, PubMed : 8969169). Signals mostly via binding to a IFNAR1-IFNAR2 heterodimeric receptor, but can also function with IFNAR1 alone and independently of Jak-STAT pathways (By similarity). Elicits a wide variety of responses, including antiviral and antibacterial activities, and can regulate the development of B-cells, myelopoiesis and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor (By similarity). Plays a role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons : acts by promoting neuronal autophagy and alpha-synuclein clearance, thereby preventing dopaminergic neuron loss (By similarity). IFNB1 is more potent than interferon-alpha (IFN-alpha) in inducing the apoptotic and antiproliferative pathways required for control of tumor cell growth (By similarity).
See full target information IFNB1

Publications (7)

Recent publications for all applications. Explore the full list and refine your search

Viruses 17: PubMed40573387

2025

A Fluorescent Reporter Virus Toolkit for Interrogating Enterovirus Biology and Host Interactions.

Applications

Unspecified application

Species

Unspecified reactive species

Mireya Martínez-Pérez,Sebastian Velandia-Álvarez,Cristina Vidal-Verdú,Beatriz Álvarez-Rodríguez,Ron Geller

PLoS biology 22:e3002709 PubMed39012844

2024

Mapping mutational fitness effects across the coxsackievirus B3 proteome reveals distinct profiles of mutation tolerability.

Applications

Unspecified application

Species

Unspecified reactive species

Beatriz Álvarez-Rodríguez,Sebastian Velandia-Álvarez,Christina Toft,Ron Geller

British journal of cancer 129:1852-1862 PubMed37838813

2023

Preoperative chemoradiotherapy induces multiple pathways related to anti-tumour immunity in rectal cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Ioannis M Koukourakis,Erasmia Xanthopoulou,Theologos I Sgouras,Maria Kouroupi,Alexandra Giatromanolaki,Vassilios Kouloulias,Dina Tiniakos,Anna Zygogianni

The EMBO journal 42:e110597 PubMed36912165

2023

DNA sensing via the cGAS/STING pathway activates the immunoproteasome and adaptive T-cell immunity.

Applications

Unspecified application

Species

Unspecified reactive species

Xinyuan Wang,Huabin Zhang,Yuqin Wang,Laylan Bramasole,Kai Guo,Fatima Mourtada,Thomas Meul,Qianjiang Hu,Valeria Viteri,Ilona Kammerl,Melanie Konigshoff,Mareike Lehmann,Thomas Magg,Fabian Hauck,Isis E Fernandez,Silke Meiners

The Journal of biological chemistry 298:102698 PubMed36379255

2022

The E3 ligase subunit FBXO45 binds the interferon-λ receptor and promotes its degradation during influenza virus infection.

Applications

Unspecified application

Species

Unspecified reactive species

MuChun Tsai,Wissam Osman,Jessica Adair,Rabab ElMergawy,Lexie Chafin,Finny Johns,Daniela Farkas,Ajit Elhance,James Londino,Rama K Mallampalli

Pharmaceutical research 40:927-935 PubMed36163411

2022

Preventing SARS-CoV-2 Infection Using Anti-spike Nanobody-IFN-β Conjugated Exosomes.

Applications

Unspecified application

Species

Unspecified reactive species

Xiabing Lyu,Shota Imai,Tomoyoshi Yamano,Rikinari Hanayama

The FEBS journal 289:808-831 PubMed34528388

2021

APOBEC3C, a nucleolar protein induced by genotoxins, is excluded from DNA damage sites.

Applications

Unspecified application

Species

Unspecified reactive species

Daniel Constantin,Gilles Dubuis,María Del Carmen Conde-Rubio,Christian Widmann
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com