JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177731

Recombinant Human IRF5 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IRF5 protein is a Human Fragment protein, in the 176 to 240 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Interferon regulatory factor 5, IRF-5, IRF5

1 Images
SDS-PAGE - Recombinant Human IRF5 protein (AB177731)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human IRF5 protein (AB177731)

15% SDS-PAGE analysis of ab177731 (3μg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q13568

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLI","proteinLength":"Fragment","predictedMolecularWeight":"10.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":240,"aminoAcidStart":176,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13568","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IRF5 or Interferon Regulatory Factor 5 is a member of the IRF family of transcription factors. This protein weighs approximately 56 kDa and is expressed in cells of the immune system including B cells dendritic cells and macrophages. IRF5 plays an important role in regulating the transcription of interferon-stimulated genes following a viral infection. It acts by binding to specific DNA sequences initiating transcription processes that are important for the antiviral response.
Biological function summary

IRF5 influences the immune response through the regulation of cytokine production. It activates genes involved in producing pro-inflammatory cytokines such as TNF-α and IL-6 which are important for clearing viral infections and activating immune cells. IRF5 does not usually form part of a protein complex but it interacts closely with TRAF6 and MyD88 for its activation. Its pivotal role in cytokine production highlights its importance in controlling inflammation.

Pathways

IRF5 is an important component of the Toll-like receptor (TLR) signaling pathway and plays a role in the MyD88-dependent pathway. In this context IRF5 gets activated by TLRs interacting with MyD88 and TAK1 to enhance the transcription of important genes for immune response. It is also closely connected to the IRF3 protein which shares similar activation pathways and can similarly initiate an antiviral state.

Defects or dysregulation in IRF5 function are linked to autoimmune diseases such as systemic lupus erythematosus (SLE) and rheumatoid arthritis. In SLE IRF5 influences autoantibody production contributing to disease development. It works alongside other regulatory proteins involved in autoimmunity including IFN-α and STAT4 which also play significant roles in modulating immune responses. Understanding IRF5's role in these conditions could present new opportunities for therapeutic interventions using IRF5 inhibitors.

Specifications

Form

Liquid

Additional notes

ab177731 purified using conventional chromatography techniques.

General info

Function

Transcription factor that plays a critical role in innate immunity by activating expression of type I interferon (IFN) IFNA and INFB and inflammatory cytokines downstream of endolysosomal toll-like receptors TLR7, TLR8 and TLR9 (PubMed : 11303025, PubMed : 15695821, PubMed : 22412986, PubMed : 25326418, PubMed : 32433612). Regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters (By similarity). Can efficiently activate both the IFN-beta (IFNB) and the IFN-alpha (IFNA) genes and mediate their induction downstream of the TLR-activated, MyD88-dependent pathway (By similarity). Key transcription factor regulating the IFN response during SARS-CoV-2 infection (PubMed : 33440148).

Sequence similarities

Belongs to the IRF family.

Post-translational modifications

Phosphorylation of serine and threonine residues by IKBKB in a C-terminal autoinhibitory region, stimulates dimerization, transport into the nucleus, assembly with the coactivator CBP/EP300 and initiation of transcription.. 'Lys-63'-linked polyubiquitination by TRAF6 is required for activation.

Subcellular localisation

Nucleus

Product protocols

Target data

Transcription factor that plays a critical role in innate immunity by activating expression of type I interferon (IFN) IFNA and INFB and inflammatory cytokines downstream of endolysosomal toll-like receptors TLR7, TLR8 and TLR9 (PubMed : 11303025, PubMed : 15695821, PubMed : 22412986, PubMed : 25326418, PubMed : 32433612). Regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters (By similarity). Can efficiently activate both the IFN-beta (IFNB) and the IFN-alpha (IFNA) genes and mediate their induction downstream of the TLR-activated, MyD88-dependent pathway (By similarity). Key transcription factor regulating the IFN response during SARS-CoV-2 infection (PubMed : 33440148).
See full target information IRF5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com