JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB137153

Recombinant Human IRGM protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IRGM protein (denatured) (His tag N-Terminus) is a Human Fragment protein, in the 23 to 181 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

IFI1, IRGM1, LRG47, IRGM, Immunity-related GTPase family M protein, Immunity-related GTPase family M protein 1, Interferon-inducible protein 1, LPS-stimulated RAW 264.7 macrophage protein 47 homolog, LRG-47

1 Images
SDS-PAGE - Recombinant Human IRGM protein (denatured) (His tag N-Terminus) (AB137153)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human IRGM protein (denatured) (His tag N-Terminus) (AB137153)

15% SDS-PAGE analysis of 3 µg ab137153.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

A1A4Y4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 12.01% Urea, 10% Glycerol (glycerin, glycerine), 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY","proteinLength":"Fragment","predictedMolecularWeight":"20.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":181,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"A1A4Y4","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IRGM also known as Immunity-Related GTPase Family M is a small protein with a molecular mass of approximately 22 kDa. This protein is mostly expressed in immune cells such as macrophages and dendritic cells. IRGM engages in autophagy a cellular process that eliminates intracellular pathogens and maintains cellular homeostasis. Its involvement in autophagy makes it an important player in immune defense mechanisms.
Biological function summary

IRGM functions to regulate innate immune responses. It is part of the ATG (autophagy-related) complex where it facilitates the formation of autophagosomes. This protein initiates the degradation of microbial invaders and damaged organelles contributing to the host defense systems. IRGM can also modulate inflammatory responses by interacting with other immune components ensuring a balance between pathogen clearance and tissue damage prevention.

Pathways

IRGM holds a connection to the autophagy pathway where it works together with proteins like LC3 and p62/sequestosome 1. This pathway is important for the degradation of pathogens engulfed in autophagosomes. In addition IRGM is involved in the intracellular signaling pathways that respond to bacterial infections collaborating with NOD2 and other pattern recognition receptors to enhance immune response.

IRGM has shown links to Crohn's disease and tuberculosis. Crohn's disease a type of inflammatory bowel disease sees IRGM influencing autophagy pathways which affects the host's ability to handle gut microbiota and microbial pathogens. In tuberculosis IRGM helps control Mycobacterium tuberculosis infection through autophagy-mediated pathways. Disruptions in IRGM functions can impair effective autophagic response influencing the progression of these diseases.

Specifications

Form

Liquid

General info

Function

Immunity-related GTPase that plays important roles in innate immunity and inflammatory response (PubMed : 16888103, PubMed : 19165925, PubMed : 25891078). Acts as a dynamin-like protein that binds to intracellular membranes and promotes remodeling and trafficking of those membranes (By similarity). Required for clearance of acute protozoan and bacterial infections by interacting with autophagy and lysosome regulatory proteins, thereby promoting the fusion of phagosomes with lysosomes for efficient degradation of cargo including microbes (PubMed : 16888103, PubMed : 25891078, PubMed : 29420192, PubMed : 32939830). Regulates selective autophagy, including xenophagy and mitophagy, both directly and indirectly (PubMed : 16888103, PubMed : 25891078, PubMed : 29420192, PubMed : 32939830). Directly regulates autophagy by acting as a molecular adapter that promotes the coassembly of the core autophagy machinery to mediate antimicrobial defense : IRGM (1) activates AMPK, which in turn phosphorylates ULK1 and BECN1 to induce autophagy, (2) promotes the coassembly of ULK1 and BECN1, enhancing BECN1-interacting partners and (3) influences the composition of the BECN1 complex, by competing with the negative regulators BCL2 and RUBCN, to trigger autophagy (PubMed : 25891078). Also activates autophagy by promoting recruitment of STX17 to autophagosomes (PubMed : 29420192). In collaboration with ATG8 proteins, regulate lysosomal biogenesis, a fundamental process for any autophagic pathway, by promoting TFEB dephosphorylation (PubMed : 32753672). Also modulates autophagy by assisting with autophagosome formation and preventing lysosomal deacidification (By similarity). While activating autophagy, acts as a key negative regulator of the inflammatory and interferon responses both by (1) promoting mitophagy and (2) mediating autophagy-dependent degradation of effectors of the inflammatory response (PubMed : 30612879, PubMed : 32715615, PubMed : 36221902). Promotes degradation of damaged and IFNG/IFN-gamma-stressed mitochondria via mitophagy, preventing cytosolic release of ligands that activate inflammation (PubMed : 32715615). Acts as a suppressor of inflammation by promoting recruitment of inflammation effectors, such as CGAS, RIGI/RIG-I and NLRP3, to autophagosome membranes, leading to their SQSTM1/p62-dependent autophagic degradation (PubMed : 30612879, PubMed : 32715615). Also directly inhibits assembly of the NLRP3 inflammasome by preventing the association between NLRP3 and PYCARD (PubMed : 30612879). Acts as a negative regulator of antiviral innate immune response by suppressing the RIPK2-dependent pro-inflammatory response : mediates recruitment of RIPosomes, composed of RIPK2 and NOD1 or NOD2, to autophagosome membranes, promoting their SQSTM1/p62-dependent autophagic degradation (PubMed : 34467632, PubMed : 36221902).. Isoform IRGMd. Acts as a positive regulator of mitophagy in response to intracellular mycobacteria infection : specifically binds cardiolipin, leading to its translocation to mitochondria, where it promotes affected mitochondrial fission and mitophagy.. (Microbial infection) Following infection by hepatitis C virus (HCV), promotes HCV-triggered membrane remodeling, leading to autophagy and Golgi fragmentation, a step required for HCV replication.

Sequence similarities

Belongs to the TRAFAC class dynamin-like GTPase superfamily. IRG family.

Post-translational modifications

Ubiquitinated via 'Lys-63'-linked polyubiquitination in a NOD2-dependent process. 'Lys-63'-linked polyubiquitination is required for interactions with the core autophagy factors.

Product protocols

Target data

Immunity-related GTPase that plays important roles in innate immunity and inflammatory response (PubMed : 16888103, PubMed : 19165925, PubMed : 25891078). Acts as a dynamin-like protein that binds to intracellular membranes and promotes remodeling and trafficking of those membranes (By similarity). Required for clearance of acute protozoan and bacterial infections by interacting with autophagy and lysosome regulatory proteins, thereby promoting the fusion of phagosomes with lysosomes for efficient degradation of cargo including microbes (PubMed : 16888103, PubMed : 25891078, PubMed : 29420192, PubMed : 32939830). Regulates selective autophagy, including xenophagy and mitophagy, both directly and indirectly (PubMed : 16888103, PubMed : 25891078, PubMed : 29420192, PubMed : 32939830). Directly regulates autophagy by acting as a molecular adapter that promotes the coassembly of the core autophagy machinery to mediate antimicrobial defense : IRGM (1) activates AMPK, which in turn phosphorylates ULK1 and BECN1 to induce autophagy, (2) promotes the coassembly of ULK1 and BECN1, enhancing BECN1-interacting partners and (3) influences the composition of the BECN1 complex, by competing with the negative regulators BCL2 and RUBCN, to trigger autophagy (PubMed : 25891078). Also activates autophagy by promoting recruitment of STX17 to autophagosomes (PubMed : 29420192). In collaboration with ATG8 proteins, regulate lysosomal biogenesis, a fundamental process for any autophagic pathway, by promoting TFEB dephosphorylation (PubMed : 32753672). Also modulates autophagy by assisting with autophagosome formation and preventing lysosomal deacidification (By similarity). While activating autophagy, acts as a key negative regulator of the inflammatory and interferon responses both by (1) promoting mitophagy and (2) mediating autophagy-dependent degradation of effectors of the inflammatory response (PubMed : 30612879, PubMed : 32715615, PubMed : 36221902). Promotes degradation of damaged and IFNG/IFN-gamma-stressed mitochondria via mitophagy, preventing cytosolic release of ligands that activate inflammation (PubMed : 32715615). Acts as a suppressor of inflammation by promoting recruitment of inflammation effectors, such as CGAS, RIGI/RIG-I and NLRP3, to autophagosome membranes, leading to their SQSTM1/p62-dependent autophagic degradation (PubMed : 30612879, PubMed : 32715615). Also directly inhibits assembly of the NLRP3 inflammasome by preventing the association between NLRP3 and PYCARD (PubMed : 30612879). Acts as a negative regulator of antiviral innate immune response by suppressing the RIPK2-dependent pro-inflammatory response : mediates recruitment of RIPosomes, composed of RIPK2 and NOD1 or NOD2, to autophagosome membranes, promoting their SQSTM1/p62-dependent autophagic degradation (PubMed : 34467632, PubMed : 36221902).. Isoform IRGMd. Acts as a positive regulator of mitophagy in response to intracellular mycobacteria infection : specifically binds cardiolipin, leading to its translocation to mitochondria, where it promotes affected mitochondrial fission and mitophagy.. (Microbial infection) Following infection by hepatitis C virus (HCV), promotes HCV-triggered membrane remodeling, leading to autophagy and Golgi fragmentation, a step required for HCV replication.
See full target information IRGM

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com