JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152902

Recombinant Human IRS2 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human IRS2 protein (GST tag N-Terminus) is a Human Fragment protein, in the 494 to 603 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Insulin receptor substrate 2, IRS-2, IRS2

1 Images
SDS-PAGE - Recombinant Human IRS2 protein (GST tag N-Terminus) (AB152902)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human IRS2 protein (GST tag N-Terminus) (AB152902)

ab152902 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q9Y4H2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRA","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":603,"aminoAcidStart":494,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9Y4H2","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Insulin Receptor Substrate 2 (IRS2) is an important cytoplasmic adaptor protein involved in insulin signaling. Alternate names for IRS2 include IRS-2 or HEK293 products IRS2. It plays a role in transducing signals from the insulin receptor tyrosine kinase to downstream effectors. IRS2 has a molecular mass of approximately 180 kDa. Expression of IRS2 occurs in many tissues with significant presence in liver and skeletal muscle indicating its broad physiological role.
Biological function summary

IRS2 acts in signal transduction and is a part of the insulin and insulin-like growth factor signaling pathways. IRS2 does not function alone but interacts with other molecules to propagate signals that regulate cellular processes. It is essential for glucose homeostasis and lipid metabolism playing a critical role in maintaining energy balance within the organism. IRS2 also mediates other biological processes like cell growth and differentiation.

Pathways

With regards to pathways IRS2 is involved in the insulin signaling and mTOR pathways. It serves as an important junction between metabolic and growth-promoting signals. Activation of IRS2 through insulin receptors leads to downstream signaling involving PI3K and Akt essential for mediating metabolic actions of insulin. It also interacts with mTOR a central protein in cell growth regulation. These pathways illustrate the integration of IRS2 in broader cellular responses to growth signals and energy availability.

IRS2 is linked to conditions like type 2 diabetes and obesity. Dysregulation of IRS2-mediated signaling can contribute to insulin resistance a characteristic feature of type 2 diabetes. In such disorders IRS2 signaling may be impaired or altered affecting its interaction with proteins like PI3K and Akt which are also implicated in these conditions. Furthermore chronic imbalance in IRS2 activity may contribute to obesity as it affects key metabolic pathways that regulate fat storage and energy expenditure.

Specifications

Form

Liquid

General info

Function

Signaling adapter protein that participates in the signal transduction from two prominent receptor tyrosine kinases, insulin receptor/INSR and insulin-like growth factor I receptor/IGF1R (PubMed : 25879670). Plays therefore an important role in development, growth, glucose homeostasis as well as lipid metabolism (PubMed : 24616100). Upon phosphorylation by the insulin receptor, functions as a signaling scaffold that propagates insulin action through binding to SH2 domain-containing proteins including the p85 regulatory subunit of PI3K, NCK1, NCK2, GRB2 or SHP2 (PubMed : 15316008, PubMed : 19109239). Recruitment of GRB2 leads to the activation of the guanine nucleotide exchange factor SOS1 which in turn triggers the Ras/Raf/MEK/MAPK signaling cascade (By similarity). Activation of the PI3K/AKT pathway is responsible for most of insulin metabolic effects in the cell, and the Ras/Raf/MEK/MAPK is involved in the regulation of gene expression and in cooperation with the PI3K pathway regulates cell growth and differentiation. Acts a positive regulator of the Wnt/beta-catenin signaling pathway through suppression of DVL2 autophagy-mediated degradation leading to cell proliferation (PubMed : 24616100). Plays a role in cell cycle progression by promoting a robust spindle assembly checkpoint (SAC) during M-phase (PubMed : 32554797). In macrophages, IL4-induced tyrosine phosphorylation of IRS2 leads to the recruitment and activation of phosphoinositide 3-kinase (PI3K) (PubMed : 19109239).

Post-translational modifications

Phosphorylation fluctuates in a cell-cycle dependent manner with hyperphosphorylation during mitosis (PubMed:32554797). Phosphorylated at Ser-560 and Ser-1109 by PLK1; these phosphorylations prevent the activation of the PI3K pathway upon growth factor stimulation by inhibiting the binding between IRS2 and the PI3K pathway components and increasing the level of IRS2 protein degradation. In addition, they prevent premature mitotic exit (By similarity).. Monoubiquitinated by NEDD4; leading to enhanced IGF1 signaling. During cell cycle, ubiquitination and proteasomal degradation are controlled by FZR1 (PubMed:32554797).

Product protocols

Target data

Signaling adapter protein that participates in the signal transduction from two prominent receptor tyrosine kinases, insulin receptor/INSR and insulin-like growth factor I receptor/IGF1R (PubMed : 25879670). Plays therefore an important role in development, growth, glucose homeostasis as well as lipid metabolism (PubMed : 24616100). Upon phosphorylation by the insulin receptor, functions as a signaling scaffold that propagates insulin action through binding to SH2 domain-containing proteins including the p85 regulatory subunit of PI3K, NCK1, NCK2, GRB2 or SHP2 (PubMed : 15316008, PubMed : 19109239). Recruitment of GRB2 leads to the activation of the guanine nucleotide exchange factor SOS1 which in turn triggers the Ras/Raf/MEK/MAPK signaling cascade (By similarity). Activation of the PI3K/AKT pathway is responsible for most of insulin metabolic effects in the cell, and the Ras/Raf/MEK/MAPK is involved in the regulation of gene expression and in cooperation with the PI3K pathway regulates cell growth and differentiation. Acts a positive regulator of the Wnt/beta-catenin signaling pathway through suppression of DVL2 autophagy-mediated degradation leading to cell proliferation (PubMed : 24616100). Plays a role in cell cycle progression by promoting a robust spindle assembly checkpoint (SAC) during M-phase (PubMed : 32554797). In macrophages, IL4-induced tyrosine phosphorylation of IRS2 leads to the recruitment and activation of phosphoinositide 3-kinase (PI3K) (PubMed : 19109239).
See full target information Insulin receptor substrate 2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com