JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB103306

Recombinant Human ISCU protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ISCU protein (His tag N-Terminus) is a Human Full Length protein, in the 35 to 167 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

NIFUN, ISCU, Iron-sulfur cluster assembly enzyme ISCU, NifU-like N-terminal domain-containing protein, NifU-like protein

1 Images
SDS-PAGE - Recombinant Human ISCU protein (His tag N-Terminus) (AB103306)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ISCU protein (His tag N-Terminus) (AB103306)

15% SDS-PAGE analysis of 3μg ab103306.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9H1K1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0308% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK","proteinLength":"Full Length","predictedMolecularWeight":"16.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":167,"aminoAcidStart":35,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9H1K1","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ISCU also known as the iron-sulfur cluster scaffold protein is an important player in the assembly of iron-sulfur clusters. This protein possesses a molecular mass of approximately 14 kDa and is widely expressed in mitochondria highlighting its central involvement in cellular processes dependent on these organelles. ISCU interacts with several proteins to facilitate the transfer of iron-sulfur clusters to apoproteins ensuring the proper maturation of these metalloproteins necessary for a variety of cellular functions.
Biological function summary

ISCU protein functions as an important scaffold component in the biosynthesis of iron-sulfur (Fe-S) clusters which are integral for the activity of multiple enzymatic and non-enzymatic systems. Within the mitochondria ISCU forms part of a multi-component complex that includes other scaffold proteins and necessary enzymes such as cysteine desulfurase which provides sulfur for cluster assembly. This complex orchestrates the precise coordination of metal ions and scaffold protein interactions facilitating cluster formation.

Pathways

The iron-sulfur cluster scaffold ISCU is vital in the electron transport chain and the citric acid cycle both of which are central to energy production in cells. ISCU closely interacts with proteins like frataxin which delivers iron to the scaffold and ferredoxin which is involved in electron transfer. These interactions highlight the pathway interdependence that maintains cellular bioenergetics and redox balance.

Disruptions in ISCU expression or function link to conditions such as Myopathy with exercise intolerance and Friedreich’s ataxia. Altered iron-sulfur cluster biogenesis impairs energy metabolism affecting muscle and neural tissues. ISCU's partnership with the frataxin protein becomes significant here as frataxin mutations result in similar pathological features thereby providing a potential target for therapeutic intervention in related diseases.

Specifications

Form

Liquid

Additional notes

ab103306 was purified using conventional chromatography techniques.

General info

Function

Isoform 1. Mitochondrial scaffold protein, of the core iron-sulfur cluster (ISC) assembly complex, that provides the structural architecture on which the [2Fe-2S] clusters are assembled (PubMed : 34824239). The core iron-sulfur cluster (ISC) assembly complex is involved in the de novo synthesis of a [2Fe-2S] cluster, the first step of the mitochondrial iron-sulfur protein biogenesis. This process is initiated by the cysteine desulfurase complex (NFS1 : LYRM4 : NDUFAB1) that produces persulfide which is delivered on the scaffold protein ISCU in a FXN-dependent manner. Then this complex is stabilized by FDX2 which provides reducing equivalents to accomplish the [2Fe-2S] cluster assembly. Finally, the [2Fe-2S] cluster is transferred from ISCU to chaperone proteins, including HSCB, HSPA9 and GLRX5 (Probable) (PubMed : 24971490, PubMed : 29576242, PubMed : 30031876, PubMed : 34824239). Exists as two slow interchanging conformational states, a structured (S) and disordered (D) form (PubMed : 23940031). May modulate NFS1 desulfurase activity in a zinc-dependent manner (PubMed : 30031876). Modulates the interaction between FXN and the cysteine desulfurase complex (PubMed : 29576242).. Isoform 2. Cytoplasmic scaffold protein, of the cytoplasmic core iron-sulfur cluster (ISC) assembly complex that provides the structural architecture on which the Fe-S clusters are assembled and may be involved in the cytoplasmic iron-sulfur protein biogenesis.

Sequence similarities

Belongs to the NifU family.

Post-translational modifications

Phosphorylation at Ser-14 is required for ISCU protein stabilization in the cytosol, whereas dephosphorylation of Ser-14, due to the inhibition of mTORC1 (mammalian target of rapamycin complex

  1. complex, leads to degradation of the precursor form and ultimately to a decrease in the mitochondrial mature form.. Cysteine persulfide is reduced by thiol-containing molecules such as glutathione and L-cysteine.
Subcellular localisation

Mitochondrion

Product protocols

Target data

Isoform 1. Mitochondrial scaffold protein, of the core iron-sulfur cluster (ISC) assembly complex, that provides the structural architecture on which the [2Fe-2S] clusters are assembled (PubMed : 34824239). The core iron-sulfur cluster (ISC) assembly complex is involved in the de novo synthesis of a [2Fe-2S] cluster, the first step of the mitochondrial iron-sulfur protein biogenesis. This process is initiated by the cysteine desulfurase complex (NFS1 : LYRM4 : NDUFAB1) that produces persulfide which is delivered on the scaffold protein ISCU in a FXN-dependent manner. Then this complex is stabilized by FDX2 which provides reducing equivalents to accomplish the [2Fe-2S] cluster assembly. Finally, the [2Fe-2S] cluster is transferred from ISCU to chaperone proteins, including HSCB, HSPA9 and GLRX5 (Probable) (PubMed : 24971490, PubMed : 29576242, PubMed : 30031876, PubMed : 34824239). Exists as two slow interchanging conformational states, a structured (S) and disordered (D) form (PubMed : 23940031). May modulate NFS1 desulfurase activity in a zinc-dependent manner (PubMed : 30031876). Modulates the interaction between FXN and the cysteine desulfurase complex (PubMed : 29576242).. Isoform 2. Cytoplasmic scaffold protein, of the cytoplasmic core iron-sulfur cluster (ISC) assembly complex that provides the structural architecture on which the Fe-S clusters are assembled and may be involved in the cytoplasmic iron-sulfur protein biogenesis.
See full target information ISCU

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com