JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB78929

Recombinant Human ISG15 protein (Calmodulin tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human ISG15 protein (Calmodulin tag N-Terminus) is a Human Full Length protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

G1P2, UCRP, ISG15, Ubiquitin-like protein ISG15, Interferon-induced 15 kDa protein, Interferon-induced 17 kDa protein, Ubiquitin cross-reactive protein, IP17, hUCRP

1 Images
SDS-PAGE - Recombinant Human ISG15 protein (Calmodulin tag N-Terminus) (AB78929)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ISG15 protein (Calmodulin tag N-Terminus) (AB78929)

15% SDS-PAGE showing ab78929 at approximately 34kDa (5μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Calmodulin tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P05161

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.58% Sodium chloride, 0.242% Tris, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKGSMGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P05161","tags":[{"tag":"Calmodulin","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ISG15 also known as G1P2 is a ubiquitin-like protein with a molecular weight of approximately 17 kDa. This protein gets expressed highly in response to interferon stimulation particularly in white blood cells such as macrophages and monocytes. It consists of two ubiquitin-like domains contributing to its functionality. ISG15 performs its mechanical role by adding itself to target proteins in a process known as ISGylation. This process resembles ubiquitination and serves to modify the functions of targeted proteins.
Biological function summary

ISG15 plays an important role in the immune response to viral infections. It acts as an antiviral agent by inhibiting viral replication. It interacts with and becomes a part of protein complexes modifying cellular proteins involved in immune regulation. ISG15 influences the stability function and localization of these target proteins enhancing antiviral defenses and potentially modulating immune signaling pathways.

Pathways

ISG15 operates within the interferon signaling pathway and the antiviral response pathway. In the interferon signaling pathway ISG15 interacts with proteins like UBE1L and UBE2L6 which act together for effective ISGylation of targets. In the antiviral response pathway ISG15 boosts the effects of proteins like IRF3 and STAT1 enhancing antiviral responses. These interactions allow ISG15 to effectively contribute to halting viral propagation.

ISG15 connects to autoimmune diseases and certain viral infections. In autoimmune conditions like systemic lupus erythematosus abnormal ISG15 activity can contribute to disease pathology. ISG15 also interacts with proteins such as USP18 which regulates the expression of type I interferons to influence the disease processes. Furthermore ISG15 involvement in viral infections such as hepatitis C highlights its value in antiviral defenses. Understanding these interactions can support the development of therapies targeting ISG15 for managing immune-related conditions.

Specifications

Form

Liquid

Additional notes

ab78929 is purified using conventional chromatography techniques. Purity is > 98% by SDS PAGE.

General info

Function

Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein (PubMed : 27564865). ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein (PubMed : 33727702). Its target proteins include IFIT1, MX1/MxA, PPM1B, UBE2L6, UBA7, CHMP5, CHMP2A, CHMP4B and CHMP6. Isgylation of the viral sensor IFIH1/MDA5 promotes IFIH1/MDA5 oligomerization and triggers activation of innate immunity against a range of viruses, including coronaviruses, flaviviruses and picornaviruses (PubMed : 33727702). Can also isgylate : EIF2AK2/PKR which results in its activation, RIGI which inhibits its function in antiviral signaling response, EIF4E2 which enhances its cap structure-binding activity and translation-inhibition activity, UBE2N and UBE2E1 which negatively regulates their activity, IRF3 which inhibits its ubiquitination and degradation and FLNB which prevents its ability to interact with the upstream activators of the JNK cascade thereby inhibiting IFNA-induced JNK signaling. Exhibits antiviral activity towards both DNA and RNA viruses, including influenza A, HIV-1 and Ebola virus. Restricts HIV-1 and ebola virus via disruption of viral budding. Inhibits the ubiquitination of HIV-1 Gag and host TSG101 and disrupts their interaction, thereby preventing assembly and release of virions from infected cells. Inhibits Ebola virus budding mediated by the VP40 protein by disrupting ubiquitin ligase activity of NEDD4 and its ability to ubiquitinate VP40. ISGylates influenza A virus NS1 protein which causes a loss of function of the protein and the inhibition of virus replication. The secreted form of ISG15 can : induce natural killer cell proliferation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL (PubMed : 29100055).

Post-translational modifications

S-nitrosylation decreases its dimerization, thereby increasing the availability as well as the solubility of monomeric ISG15 for its conjugation to cellular proteins.. Induced as an inactive, precursor protein that is cleaved by specific proteases to expose the C-terminal diglycine (LRLRGG) motif. This motif is essential not only for its conjugation to substrates but also for its recognition by the relevant processing proteases.

Product protocols

Target data

Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein (PubMed : 27564865). ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein (PubMed : 33727702). Its target proteins include IFIT1, MX1/MxA, PPM1B, UBE2L6, UBA7, CHMP5, CHMP2A, CHMP4B and CHMP6. Isgylation of the viral sensor IFIH1/MDA5 promotes IFIH1/MDA5 oligomerization and triggers activation of innate immunity against a range of viruses, including coronaviruses, flaviviruses and picornaviruses (PubMed : 33727702). Can also isgylate : EIF2AK2/PKR which results in its activation, RIGI which inhibits its function in antiviral signaling response, EIF4E2 which enhances its cap structure-binding activity and translation-inhibition activity, UBE2N and UBE2E1 which negatively regulates their activity, IRF3 which inhibits its ubiquitination and degradation and FLNB which prevents its ability to interact with the upstream activators of the JNK cascade thereby inhibiting IFNA-induced JNK signaling. Exhibits antiviral activity towards both DNA and RNA viruses, including influenza A, HIV-1 and Ebola virus. Restricts HIV-1 and ebola virus via disruption of viral budding. Inhibits the ubiquitination of HIV-1 Gag and host TSG101 and disrupts their interaction, thereby preventing assembly and release of virions from infected cells. Inhibits Ebola virus budding mediated by the VP40 protein by disrupting ubiquitin ligase activity of NEDD4 and its ability to ubiquitinate VP40. ISGylates influenza A virus NS1 protein which causes a loss of function of the protein and the inhibition of virus replication. The secreted form of ISG15 can : induce natural killer cell proliferation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL (PubMed : 29100055).
See full target information ISG15

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Frontiers in immunology 11:594775 PubMed33424843

2020

Tumor Cell-Secreted ISG15 Promotes Tumor Cell Migration and Immune Suppression by Inducing the Macrophage M2-Like Phenotype.

Applications

Unspecified application

Species

Unspecified reactive species

Ren-Hui Chen,Zhi-Wen Xiao,Xiao-Qing Yan,Ping Han,Fa-Ya Liang,Jing-Yi Wang,Shi-Tong Yu,Ting-Zhen Zhang,Si-Qi Chen,Qian Zhong,Xiao-Ming Huang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com