JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB156338

Recombinant Human ITGB3BP protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ITGB3BP protein (denatured) (His tag N-Terminus) is a Human Full Length protein, in the 1 to 216 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

CENPR, NRIF3, ITGB3BP, Centromere protein R, CENP-R, Beta-3-endonexin, Integrin beta-3-binding protein, Nuclear receptor-interacting factor 3

1 Images
SDS-PAGE - Recombinant Human ITGB3BP protein (denatured) (His tag N-Terminus) (AB156338)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ITGB3BP protein (denatured) (His tag N-Terminus) (AB156338)

15% SDS-PAGE analysis of ab156338 (3µg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q13352

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMPFAPVAQARVQWHDFRSLQHLLPAFKRFSCLSLGSSWDYSVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN","proteinLength":"Full Length","predictedMolecularWeight":"27.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":216,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13352","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein ITGB3BP also known as Interferon-induced Transmembrane Protein 1 (IFITM1) plays a role in molecular binding and signal transduction. ITGB3BP weighs approximately 58 kDa. This protein is primarily expressed in various tissues including the brain heart and placenta. Its main function involves interaction with integrin beta-3 a protein involved in the formation of cell-extracellular matrix interactions.
Biological function summary

ITGB3BP influences cellular processes such as cell adhesion migration and angiogenesis. It forms part of a larger protein complex involving integrins which often associate with intracellular cytoskeletal and signaling components. Through its binding properties ITGB3BP impacts integrin signaling pathways that contribute to tissue formation and repair.

Pathways

ITGB3BP plays significant roles in the integrin-mediated signaling and PI3K/AKT pathways. Through these pathways ITGB3BP contributes to cellular functions like survival proliferation and motility. The interaction between ITGB3BP and other proteins such as integrins and focal adhesion kinase (FAK) plays a central role in these pathways reinforcing cellular connections to the extracellular matrix.

Mutations or dysregulations in ITGB3BP expression associate with cancer and cardiovascular diseases. In cancer ITGB3BP influences tumor cell invasion and metastasis often working alongside proteins like integrins and matrix metalloproteinases. In cardiovascular diseases the aberrant function of ITGB3BP can affect vascular integrity and heart tissue remodeling potentially linked to altered interactions with integrins.

Specifications

Form

Liquid

General info

Function

Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. In contrast, it does not coactivate nuclear receptors for retinoic acid, vitamin D, progesterone receptor, nor glucocorticoid. Acts as a coactivator for estrogen receptor alpha. Acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. May also act as an inhibitor of cyclin A-associated kinase. Also acts a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

Subcellular localisation

Nucleus

Product protocols

Target data

Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. In contrast, it does not coactivate nuclear receptors for retinoic acid, vitamin D, progesterone receptor, nor glucocorticoid. Acts as a coactivator for estrogen receptor alpha. Acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. May also act as an inhibitor of cyclin A-associated kinase. Also acts a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
See full target information ITGB3BP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com