JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB160492

Recombinant Human ITM2B protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ITM2B protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 266 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

BRI, BRI2, ITM2B, Integral membrane protein 2B, Immature BRI2, Protein E25B, Transmembrane protein BRI, imBRI2, Bri

1 Images
SDS-PAGE - Recombinant Human ITM2B protein (GST tag N-Terminus) (AB160492)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ITM2B protein (GST tag N-Terminus) (AB160492)

ab160492 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q9Y287

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":266,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9Y287","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ITM2B also known as Integral Membrane Protein 2B or BRI2 is a transmembrane protein weighing approximately 30 kDa. This protein is expressed widely in human tissues showing particularly high levels in the central nervous system and brain. ITM2B functions mechanically by playing a role in protein processing and trafficking owing to its transmembrane nature. With an integral role in cellular functions ITM2B interacts with various cellular components associated with membrane-related activities.
Biological function summary

ITM2B engages in several vital cellular processes such as regulation of amyloid precursor protein (APP) processing. ITM2B forms part of a complex with other proteins involved in APP cleavage which is significant for maintaining cell homeostasis. It also influences neuronal functions through its effects on synaptic plasticity and could impact cognitive abilities. The protein's presence in brain regions ties ITM2B closely to neural activities where protein interactions are essential for cellular communication.

Pathways

ITM2B exerts influence on critical processes in amyloidogenic pathways contributing to the modulation of amyloid-beta production. This protein directly interacts with other players like APP and presenilin 1 within this pathway affecting the levels of amyloids and ultimately impacting neural integrity. Additionally ITM2B participates in Wnt signaling pathways linking it to cellular differentiation and proliferation where it modulates interactions with proteins that convey Wnt signals such as beta-catenin.

ITM2B is directly linked to familial British dementia and familial Danish dementia both neurodegenerative conditions. These diseases involve mutations in the ITM2B gene leading to abnormal protein aggregates that disrupt normal brain function. ITM2B's relationship with amyloid-beta and presenilin 1 also connects it to Alzheimer's disease pathogenesis where these proteins play roles in amyloid plaque formation a hallmark of Alzheimer's. Studies focus on targeting ITM2B interactions and processing to develop therapies for these conditions highlighting its potential as a therapeutic target.

Specifications

Form

Liquid

General info

Function

Plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. Plays a role in the induction of neurite outgrowth. Functions as a protease inhibitor by blocking access of secretases to APP cleavage sites.. Mature BRI2 (mBRI2) functions as a modulator of the amyloid-beta A4 precursor protein (APP) processing leading to a strong reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42.. Bri23 peptide prevents aggregation of APP amyloid-beta protein 42 into toxic oligomers.

Sequence similarities

Belongs to the ITM2 family.

Post-translational modifications

The ectodomain C-terminal part of the imBRI2 is processed by furin producing a secreted Bri23 peptide and a mature BRI2, membrane form (mBRI2). The remaining part of the ectodomain of mBRI2 containing the BRICHOS domain is cleaved by ADAM10 and is secreted (BRI2C, soluble form). The membrane-bound N-terminal fragment (BRI2C, membrane form) is further proteolytically processed by SPPL2A and SPPL2B through regulated intramembrane proteolysis producing a secreted C-peptide and a BRI2 intracellular domain (BRI2 ICD) released in the cytosol. Shedding by ADAM10 facilitates intramembrane cleavage but is not absolutely required for BRI2 ICD generation.. Glycosylation at Asn-170 is important for cell surface localization, but doesn't affect furin- and ADAM10-induced proteolytic processing.

Product protocols

Target data

Plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. Plays a role in the induction of neurite outgrowth. Functions as a protease inhibitor by blocking access of secretases to APP cleavage sites.. Mature BRI2 (mBRI2) functions as a modulator of the amyloid-beta A4 precursor protein (APP) processing leading to a strong reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42.. Bri23 peptide prevents aggregation of APP amyloid-beta protein 42 into toxic oligomers.
See full target information ITM2B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com