JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB216194

Recombinant human JAK1 protein (Active) (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human JAK1 protein (Active) (GST tag N-Terminus) is a Human Fragment protein, in the 866 to 1154 aa range, expressed in Baculovirus infected Sf9 cells, with >35%, suitable for SDS-PAGE, FuncS.

View Alternative Names

JAK1A, JAK1B, JAK1, Tyrosine-protein kinase JAK1, Janus kinase 1, JAK-1

2 Images
Functional Studies - Recombinant human JAK1 protein (Active) (GST tag N-Terminus) (AB216194)
  • FuncS

Supplier Data

Functional Studies - Recombinant human JAK1 protein (Active) (GST tag N-Terminus) (AB216194)

Example of specific activity of ab216194.

SDS-PAGE - Recombinant human JAK1 protein (Active) (GST tag N-Terminus) (AB216194)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human JAK1 protein (Active) (GST tag N-Terminus) (AB216194)

10% SDS-PAGE with Coomassie staining :

Lane 1 : ab216194

Lane 2 : MW marker

Key facts

Purity

>35% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific Activity: 1.0 pmol/min/μg.

Assay Conditions: Enzyme reaction is conducted at 30°C for 1 hour in a buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl2, 1 mM EGTA, 200 μM ATP, 0.01% Brij-35 and 2 μM substrate (Tyr6) using Z-Lyte assay conditions.

Accession

P23458

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.49% Glutathione, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK","proteinLength":"Fragment","predictedMolecularWeight":"59 kDa","actualMolecularWeight":null,"aminoAcidEnd":1154,"aminoAcidStart":866,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P23458","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

JAK1 also known as Janus Kinase 1 plays an essential role in transmitting signals within cells. It is a tyrosine kinase enzyme with a molecular weight of approximately 130 kDa. JAK1 is expressed broadly in various tissues and is involved in cytokine receptor signaling. The kinase activity of JAK1 gets activated upon cytokine binding to its respective receptor which leads to phosphorylation events and downstream signaling cascades.
Biological function summary

This enzyme participates significantly in the immune response and hematopoiesis by being part of the JAK-STAT signaling pathway complex. When activated JAK1 phosphorylates specific tyrosine residues on the receptor creating docking sites for STAT proteins which then get phosphorylated by JAK1. This phosphorylation allows STAT proteins to dimerize and translocate to the nucleus affecting gene expression involved in growth survival and differentiation processes.

Pathways

JAK1 is importantly engaged in the JAK-STAT pathway and the Interferon signaling pathway. Within these pathways JAK1 collaborates closely with other proteins like JAK2 TYK2 and STAT proteins. It acts as a mediator of the cellular response to a variety of cytokines and growth factors playing a role in the regulation of immune responses and cell proliferation.

Dysregulation of JAK1 associates with autoimmune diseases like rheumatoid arthritis and certain cancers. JAK1 inhibitors have been developed as therapeutic agents for these conditions targeting its kinase activity to modulate aberrant signaling. The interaction between JAK1 and other kinases such as JAK2 and transcription factors like STATs highlights its importance in disease mechanisms providing a target for drugs to manage inflammatory and malignant disorders.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway (PubMed : 16239216, PubMed : 28111307, PubMed : 32750333, PubMed : 7615558, PubMed : 8232552). Kinase partner for the interleukin (IL)-2 receptor (PubMed : 11909529) as well as interleukin (IL)-10 receptor (PubMed : 12133952). Kinase partner for the type I interferon receptor IFNAR2 (PubMed : 16239216, PubMed : 28111307, PubMed : 32750333, PubMed : 7615558, PubMed : 8232552). In response to interferon-binding to IFNAR1-IFNAR2 heterodimer, phosphorylates and activates its binding partner IFNAR2, creating docking sites for STAT proteins (PubMed : 7759950). Directly phosphorylates STAT proteins but also activates STAT signaling through the transactivation of other JAK kinases associated with signaling receptors (PubMed : 16239216, PubMed : 32750333, PubMed : 8232552).

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.

Post-translational modifications

Autophosphorylated (PubMed:7615558). Phosphorylated by TYK2 on tyrosine residues in response to type-I interferon signaling, leading to its activation (PubMed:8232552). Phosphorylated on tyrosine residues in response to interferon gamma signaling (PubMed:7615558). Dephosphorylation of Tyr-1034 and Tyr-1035 by PTPN2 negatively regulates cytokine-mediated signaling (PubMed:11909529).. Ubiquitinated by RNF125; leading to its degradation by the proteasome.

Product protocols

Target data

Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway (PubMed : 16239216, PubMed : 28111307, PubMed : 32750333, PubMed : 7615558, PubMed : 8232552). Kinase partner for the interleukin (IL)-2 receptor (PubMed : 11909529) as well as interleukin (IL)-10 receptor (PubMed : 12133952). Kinase partner for the type I interferon receptor IFNAR2 (PubMed : 16239216, PubMed : 28111307, PubMed : 32750333, PubMed : 7615558, PubMed : 8232552). In response to interferon-binding to IFNAR1-IFNAR2 heterodimer, phosphorylates and activates its binding partner IFNAR2, creating docking sites for STAT proteins (PubMed : 7759950). Directly phosphorylates STAT proteins but also activates STAT signaling through the transactivation of other JAK kinases associated with signaling receptors (PubMed : 16239216, PubMed : 32750333, PubMed : 8232552).
See full target information JAK1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com