JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271562

Recombinant Human JAK2 (mutated V617F) protein (Tagged) (Biotin)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human JAK2 (mutated V617F) protein (Tagged) (Biotin) is a Human Fragment protein, in the 513 to 827 aa range, expressed in Baculovirus infected Sf9 cells, with >58%, suitable for SDS-PAGE.

View Alternative Names

Tyrosine-protein kinase JAK2, Janus kinase 2, JAK-2, JAK2

1 Images
SDS-PAGE - Recombinant Human JAK2 (mutated V617F) protein (Tagged) (Biotin) (AB271562)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human JAK2 (mutated V617F) protein (Tagged) (Biotin) (AB271562)

SDS-PAGE analysis of 2 μg ab271562.

Key facts

Purity

>58% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Avi tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Conjugation

Biotin

Excitation/Emission
Accession

O60674

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Preservative: 3.4% Imidazole Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Enzymatically biotin-labeled using Avi-tag™ technology

Sequence info

[{"sequence":"RTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRI","proteinLength":"Fragment","predictedMolecularWeight":"39 kDa","actualMolecularWeight":null,"aminoAcidEnd":827,"aminoAcidStart":513,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"O60674","tags":[{"tag":"Avi","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle|Store in the dark
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

JAK2 also known as Janus kinase 2 is a protein tyrosine kinase with a molecular weight of 125 kDa. It plays an essential mechanical role in the signaling pathways by acting as an intermediary between cell surface receptors and intracellular signaling molecules. The JAK2 protein binds to certain cytokine receptors facilitating signal transduction necessary for various cellular responses. JAK2 is expressed in many tissues including hematopoietic cells which are associated with the blood and immune systems.
Biological function summary

JAK2 is important for transmitting signals that dictate cell growth survival and differentiation within the hematopoietic system. It operates bodily functions by forming complexes with specific phosphorylation sites on its associated receptors. Through this formation JAK2 influences the signaling cascade particularly by interacting with other signal transducers and activators where it phosphorylates and becomes activated. This action affects gene transcription directly correlated with cellular proliferation and differentiation processes.

Pathways

The function of JAK2 integrates into the JAK-STAT signaling pathway which is an important pathway in the regulation of immune function growth and development. It works in conjunction with proteins such as STAT3 and STAT5 to transmit signals from cytokine receptors to the nucleus. This pathway critically impacts responses like inflammation and hematopoiesis aligning with its role in precursor proliferation within the bone marrow and various immune cells’ function.

JAK2 has significant implications in conditions like myeloproliferative neoplasms and polycythemia vera. Mutations in the JAK2 gene notably the JAK2 V617F mutation lead to uncontrolled cell division as they disrupt normal signaling mechanisms often resulting in blood cell disorders. In these contexts JAK2 interacts with proteins such as EpoR and MPL which play roles within these disease pathways. Understanding how JAK2 mutations contribute to disease progression offers pathways for targeted therapies.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin receptor (MPL/TPOR); or type II receptors including IFN-alpha, IFN-beta, IFN-gamma and multiple interleukins (PubMed : 15690087, PubMed : 7615558, PubMed : 9657743, PubMed : 15899890). Following ligand-binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins (PubMed : 15690087, PubMed : 9618263). Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, cell stimulation with erythropoietin (EPO) during erythropoiesis leads to JAK2 autophosphorylation, activation, and its association with erythropoietin receptor (EPOR) that becomes phosphorylated in its cytoplasmic domain (PubMed : 9657743). Then, STAT5 (STAT5A or STAT5B) is recruited, phosphorylated and activated by JAK2. Once activated, dimerized STAT5 translocates into the nucleus and promotes the transcription of several essential genes involved in the modulation of erythropoiesis. Part of a signaling cascade that is activated by increased cellular retinol and that leads to the activation of STAT5 (STAT5A or STAT5B) (PubMed : 21368206). In addition, JAK2 mediates angiotensin-2-induced ARHGEF1 phosphorylation (PubMed : 20098430). Plays a role in cell cycle by phosphorylating CDKN1B (PubMed : 21423214). Cooperates with TEC through reciprocal phosphorylation to mediate cytokine-driven activation of FOS transcription. In the nucleus, plays a key role in chromatin by specifically mediating phosphorylation of 'Tyr-41' of histone H3 (H3Y41ph), a specific tag that promotes exclusion of CBX5 (HP1 alpha) from chromatin (PubMed : 19783980). Up-regulates the potassium voltage-gated channel activity of KCNA3 (PubMed : 25644777).

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.

Post-translational modifications

Autophosphorylated, leading to regulate its activity. Leptin promotes phosphorylation on tyrosine residues, including phosphorylation on Tyr-813 (By similarity). Autophosphorylation on Tyr-119 in response to EPO down-regulates its kinase activity (By similarity). Autophosphorylation on Tyr-868, Tyr-966 and Tyr-972 in response to growth hormone (GH) are required for maximal kinase activity (By similarity). Also phosphorylated by TEC (By similarity). Phosphorylated on tyrosine residues in response to interferon gamma signaling (PubMed:7615558, PubMed:7673114). Phosphorylated on tyrosine residues in response to a signaling cascade that is activated by increased cellular retinol (PubMed:21368206).. Undergoes Notch-induced ubiquitination and subsequent proteasomal degradation which is mediated by ASB1 or ASB2, the substrate-recognition components of probable ECS E3 ubiquitin-protein ligase complexes.

Subcellular localisation

Nucleus

Product protocols

Target data

Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin receptor (MPL/TPOR); or type II receptors including IFN-alpha, IFN-beta, IFN-gamma and multiple interleukins (PubMed : 15690087, PubMed : 7615558, PubMed : 9657743, PubMed : 15899890). Following ligand-binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins (PubMed : 15690087, PubMed : 9618263). Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, cell stimulation with erythropoietin (EPO) during erythropoiesis leads to JAK2 autophosphorylation, activation, and its association with erythropoietin receptor (EPOR) that becomes phosphorylated in its cytoplasmic domain (PubMed : 9657743). Then, STAT5 (STAT5A or STAT5B) is recruited, phosphorylated and activated by JAK2. Once activated, dimerized STAT5 translocates into the nucleus and promotes the transcription of several essential genes involved in the modulation of erythropoiesis. Part of a signaling cascade that is activated by increased cellular retinol and that leads to the activation of STAT5 (STAT5A or STAT5B) (PubMed : 21368206). In addition, JAK2 mediates angiotensin-2-induced ARHGEF1 phosphorylation (PubMed : 20098430). Plays a role in cell cycle by phosphorylating CDKN1B (PubMed : 21423214). Cooperates with TEC through reciprocal phosphorylation to mediate cytokine-driven activation of FOS transcription. In the nucleus, plays a key role in chromatin by specifically mediating phosphorylation of 'Tyr-41' of histone H3 (H3Y41ph), a specific tag that promotes exclusion of CBX5 (HP1 alpha) from chromatin (PubMed : 19783980). Up-regulates the potassium voltage-gated channel activity of KCNA3 (PubMed : 25644777).
See full target information JAK2 mutated V617F

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com