JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB134536

Recombinant Human JAM-C protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human JAM-C protein (His tag N-Terminus) is a Human Fragment protein, in the 32 to 241 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

UNQ859/PRO1868, JAM3, Junctional adhesion molecule C, JAM-C, JAM-2, Junctional adhesion molecule 3, JAM-3, JAMC

1 Images
SDS-PAGE - Recombinant Human JAM-C protein (His tag N-Terminus) (AB134536)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human JAM-C protein (His tag N-Terminus) (AB134536)

15% SDS-PAGE analysis of 3 μg ab134536.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9BX67

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 50% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl, 0.08% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.06% EDTA

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as Junctional Adhesion Molecule C.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN","proteinLength":"Fragment","predictedMolecularWeight":"26 kDa","actualMolecularWeight":null,"aminoAcidEnd":241,"aminoAcidStart":32,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9BX67","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Junctional adhesion molecule-C (JAM-C) is a cell adhesion molecule belonging to the immunoglobulin superfamily also known as JAM3. It has a mass around 37 kDa. JAM-C is present on endothelial cells various immune cells and some epithelial cells. This protein functions mechanically in maintaining tight junctions that control paracellular permeability and are important in cell-to-cell interactions.
Biological function summary

Junctional adhesion molecule-C plays significant roles in leukocyte migration angiogenesis and the maintenance of vascular endothelial barrier function. JAM-C is part of a larger junctional adhesion molecule complex which includes JAM-A and JAM-B that collectively influence these processes. Its expression in tissues such as the heart and brain suggests specialized roles in physiological functions including cardiovascular regulation and CNS barriers.

Pathways

Junctional adhesion molecule-C is an integral component of the leukocyte transmigration and angiogenesis pathways. These pathways collaborate to allow immune cells to pass through vessel walls a fundamental process in immune surveillance and response. Additionally JAM-C interacts with integrins and other adhesion molecules facilitating cellular communication necessary for tissue repair and growth.

Dysregulation of junctional adhesion molecule-C expression associates with inflammatory diseases and cancer. Altered JAM-C levels have implications in autoimmune disorders where abnormal leukocyte extravasation occurs. Its connection to cancer involves interactions with proteins like VE-cadherin contributing to increased tumor angiogenesis and metastasis making it a potential target for therapeutic intervention in these conditions.

Specifications

Form

Liquid

Additional notes

ab134536 is purified using conventional chromatography techniques.

General info

Function

Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes (PubMed : 11590146, PubMed : 11823489). Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow. At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3 (PubMed : 11590146, PubMed : 24357068). Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium (By similarity). Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation (By similarity). Also functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN) (PubMed : 12208882, PubMed : 15194813). Plays a role in angiogenesis (PubMed : 23255084). Plays a role in the regulation of cell migration (Probable). During myogenesis, it is involved in myocyte fusion (By similarity).. Soluble form of JAM-C. Promotes chemotaxis of vascular endothelial cells and stimulates angiogenesis.

Sequence similarities

Belongs to the immunoglobulin superfamily.

Post-translational modifications

Proteolytically cleaved from endothelial cells surface into a soluble form by ADAM10 and ADAM17; the release of soluble JAM3 is increased by pro-inflammatory factors.. S-palmitoylated by ZDHHC7. S-palmitoylation promotes expression at tight junctions.

Product protocols

Target data

Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes (PubMed : 11590146, PubMed : 11823489). Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow. At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3 (PubMed : 11590146, PubMed : 24357068). Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium (By similarity). Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation (By similarity). Also functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN) (PubMed : 12208882, PubMed : 15194813). Plays a role in angiogenesis (PubMed : 23255084). Plays a role in the regulation of cell migration (Probable). During myogenesis, it is involved in myocyte fusion (By similarity).. Soluble form of JAM-C. Promotes chemotaxis of vascular endothelial cells and stimulates angiogenesis.
See full target information JAM3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com