JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB153629

Recombinant Human JMJD1C protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human JMJD1C protein (GST tag N-Terminus) is a Human Fragment protein, in the 2 to 99 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

JHDM2C, KDM3C, KIAA1380, TRIP8, JMJD1C, Jumonji domain-containing protein 1C, Thyroid receptor-interacting protein 8, TR-interacting protein 8, TRIP-8

1 Images
SDS-PAGE - Recombinant Human JMJD1C protein (GST tag N-Terminus) (AB153629)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human JMJD1C protein (GST tag N-Terminus) (AB153629)

ab153629 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q15652

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"IVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSD","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":99,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q15652","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

JMJD1C also known as KDM3C is a member of the Jumonji domain-containing proteins family. It acts as a histone demethylase specifically targeting histone H3 at lysine 9 (H3K9). This enzymatic function plays a role in epigenetic regulation by removing methyl groups from histone proteins influencing chromatin structure and gene expression. The protein has an approximate molecular mass of 170 kDa. It is expressed in various tissues with significant levels found in the testis brain and other central nervous system components.
Biological function summary

JMJD1C regulates gene expression linked to spermatogenesis metabolic processes and neurodevelopmental signaling. It interacts with components of transcriptional complexes having a role in the demethylation of histones to facilitate transcription. The protein also controls hormonal responses by influencing androgen receptor signaling pathways which is important in reproductive tissue function and development.

Pathways

JMJD1C integrates into metabolic and developmental regulatory networks. It is actively involved in the androgen receptor signaling pathway and the Wnt signaling pathway. Its interactions with proteins such as AR (androgen receptor) and components of the Wnt signaling orchestrate gene transcription impacting cellular growth and differentiation. By modulating these pathways JMJD1C links epigenetic modifications to broader physiological processes.

JMJD1C has been associated with cancer and neuropsychiatric disorders. Aberrant expression or mutation of JMJD1C can contribute to prostate cancer given its role in androgen receptor pathways and it has also been implicated in schizophrenia where it may influence neuronal gene expression. The protein's interaction with the androgen receptor and other transcription factors highlights its significance in these pathologies suggesting potential as a therapeutic target.

Specifications

Form

Liquid

General info

Function

Demethylates lysine in proteins, such as STAT3 or MDC1 (By similarity) (PubMed : 24240613). Demethylates MDC1, thereby promoting MDC1-RNF8 interaction and facilitating RNF8-dependent MDC1 ubiquitination essential for double-strand break (DSB) repair (PubMed : 24240613). Demethylation of STAT3 at 'Lys-140' facilitates its interactions with the phosphatase PTPN6 and restrains STAT3 activation (By similarity). It is uncertain whether JMJD1C removes methyl groups from histone proteins as the other JMJD1/KDM3 proteins do (PubMed : 23593242, PubMed : 24240613, PubMed : 32034158). Nevertheless, JMJD1C may act as a context-specific histone demethylase. Implicated in lipogenic gene transcription in the liver, where USF1 recruits JMJD1C to lipogenic promoters in response to insulin or feeding stimuli, thereby potentially promoting H3K9me2 demethylation and enhancing chromatin accessibility (PubMed : 32034158). Post-translational modifications may regulate JMJD1C's enzymatic activity, contributing to its context-specific functions (PubMed : 32034158). Alternatively, JMJD1C may influence chromatin regulation indirectly, acting as a scaffold or co-regulator that recruits or stabilizes other active demethylase complexes modifying histone marks (PubMed : 24240613). Plays an indispensable role in spermatogenesis (By similarity).. Isoform 3. Coactivator of androgen receptor.

Sequence similarities

Belongs to the JHDM2 histone demethylase family.

Post-translational modifications

Ubiquitinated. Protein abundance of JMJD1C is regulated by the ubiquitin proteasome pathway.. Phosphorylated. Phosphorylation at Thr-505 by mTORC1 complex in response to insulin/feeding.

Subcellular localisation

Nucleus

Product protocols

Target data

Demethylates lysine in proteins, such as STAT3 or MDC1 (By similarity) (PubMed : 24240613). Demethylates MDC1, thereby promoting MDC1-RNF8 interaction and facilitating RNF8-dependent MDC1 ubiquitination essential for double-strand break (DSB) repair (PubMed : 24240613). Demethylation of STAT3 at 'Lys-140' facilitates its interactions with the phosphatase PTPN6 and restrains STAT3 activation (By similarity). It is uncertain whether JMJD1C removes methyl groups from histone proteins as the other JMJD1/KDM3 proteins do (PubMed : 23593242, PubMed : 24240613, PubMed : 32034158). Nevertheless, JMJD1C may act as a context-specific histone demethylase. Implicated in lipogenic gene transcription in the liver, where USF1 recruits JMJD1C to lipogenic promoters in response to insulin or feeding stimuli, thereby potentially promoting H3K9me2 demethylation and enhancing chromatin accessibility (PubMed : 32034158). Post-translational modifications may regulate JMJD1C's enzymatic activity, contributing to its context-specific functions (PubMed : 32034158). Alternatively, JMJD1C may influence chromatin regulation indirectly, acting as a scaffold or co-regulator that recruits or stabilizes other active demethylase complexes modifying histone marks (PubMed : 24240613). Plays an indispensable role in spermatogenesis (By similarity).. Isoform 3. Coactivator of androgen receptor.
See full target information JMJD1C

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com