JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB233603

Recombinant Human Junctional Adhesion Molecule 2/JAM-B protein (Fc Chimera His Tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Junctional Adhesion Molecule 2/JAM-B protein (Fc Chimera His Tag) is a Human Fragment protein, in the 29 to 238 aa range, expressed in Baculovirus infected insect cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD322, C21orf43, VEJAM, UNQ219/PRO245, JAM2, Junctional adhesion molecule B, JAM-B, Junctional adhesion molecule 2, Vascular endothelial junction-associated molecule, JAM-2, VE-JAM

1 Images
SDS-PAGE - Recombinant Human Junctional Adhesion Molecule 2/JAM-B protein (Fc Chimera His Tag) (AB233603)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Junctional Adhesion Molecule 2/JAM-B protein (Fc Chimera His Tag) (AB233603)

15% SDS-PAGE analysis of 3 μg ab233603.

MW : 50-70 kDa (SDS-PAGE under reducing conditions).

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

Fc tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P57087

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as Junctional Adhesion Molecule 2.

Sequence info

[{"sequence":"ADPFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"50.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":238,"aminoAcidStart":29,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"P57087","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Junctional Adhesion Molecule 2 also known as JAM-B JAM B or JAM Protein is a member of the immunoglobulin superfamily of proteins. It has a molecular mass of approximately 38 kDa and is expressed on the surface of endothelial and epithelial cells. JAM-B plays an important role in regulating cellular adhesion facilitating the interaction between adjacent cells. This target is important in maintaining cell polarity and integrity making it an adhesion example of the body’s cellular architecture.
Biological function summary

Junctional adhesion molecule 2 participates in a range of processes related to the formation and maintenance of tight junctions. It is a component of the tight junction complex interacting with other proteins to influence barrier function in vascular and epithelial tissues. This molecule is involved in leukocyte transmigration which is essential during inflammation as leukocytes need to exit the bloodstream to reach sites of infection or injury. It partners with other tight junction proteins which assists in its role in cell adhesion dynamics.

Pathways

JAM-B is involved in the regulation of the leukocyte adhesion cascade and tight junction signaling. Its function is interlinked with the integrin and chemokine pathways influencing leukocyte migration. Junctional adhesion molecule 2 associates with proteins like integrins and PECAM-1 playing a part in the orchestration of cellular movements and interactions that are critical to proper immune response and tissue homeostasis.

Junctional adhesion molecule 2 correlation exists with inflammatory diseases and cancer. Its role in leukocyte transmigration links it to inflammatory conditions where increased or disrupted JAM-B expression can affect immune cell infiltration and inflammation severity. In cancer aberrant JAM-B expression can influence tumor growth and metastasis due to its impact on cell adhesion and migration. JAM-B interacts with PD-1 in the context of these diseases highlighting its part in immune regulation and signaling networks associated with tumor progression.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM3 to regulate different cellular processes (PubMed : 11590146, PubMed : 11823489, PubMed : 24357068). Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow (PubMed : 24357068). At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3 (PubMed : 11590146, PubMed : 24357068). Plays a central role in leukocytes extravasation by facilitating not only transmigration but also tethering and rolling of leukocytes along the endothelium (PubMed : 12239159). Tethering and rolling of leukocytes are dependent on the binding by JAM2 of the integrin alpha-4/beta-1 (PubMed : 12070135). Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation (By similarity). Also functions as an inhibitory somatodendritic cue that prevents the myelination of non-axonal parts of neurons (By similarity). During myogenesis, it is involved in myocyte fusion (By similarity). May also play a role in angiogenesis (By similarity).

Sequence similarities

Belongs to the immunoglobulin superfamily.

Product protocols

Target data

Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM3 to regulate different cellular processes (PubMed : 11590146, PubMed : 11823489, PubMed : 24357068). Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow (PubMed : 24357068). At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3 (PubMed : 11590146, PubMed : 24357068). Plays a central role in leukocytes extravasation by facilitating not only transmigration but also tethering and rolling of leukocytes along the endothelium (PubMed : 12239159). Tethering and rolling of leukocytes are dependent on the binding by JAM2 of the integrin alpha-4/beta-1 (PubMed : 12070135). Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation (By similarity). Also functions as an inhibitory somatodendritic cue that prevents the myelination of non-axonal parts of neurons (By similarity). During myogenesis, it is involved in myocyte fusion (By similarity). May also play a role in angiogenesis (By similarity).
See full target information JAM2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com