JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB111648

Recombinant Human KAT2A / GCN5 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human KAT2A / GCN5 protein is a Human Fragment protein, in the 411 to 837 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

GCN5, GCN5L2, KAT2A, Histone acetyltransferase KAT2A, General control of amino acid synthesis protein 5-like 2, Histone acetyltransferase GCN5, Histone glutaryltransferase KAT2A, Histone succinyltransferase KAT2A, Lysine acetyltransferase 2A, STAF97, hGCN5

2 Images
SDS-PAGE - Recombinant Human KAT2A / GCN5 protein (AB111648)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human KAT2A / GCN5 protein (AB111648)

3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

SDS-PAGE - Recombinant Human KAT2A / GCN5 protein (AB111648)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human KAT2A / GCN5 protein (AB111648)

15% SDS-PAGE analysis of ab111648 (3 μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q92830

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl, 0.08% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.03% EDTA

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK","proteinLength":"Fragment","predictedMolecularWeight":"51.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":837,"aminoAcidStart":411,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q92830","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

KAT2A also known as GCN5 is a lysine acetyltransferase enzyme with a molecular mass of approximately 92 kDa. It mainly acetylates histone proteins and affects transcriptional regulation by modifying chromatin structure. KAT2A/GCN5 is expressed in various tissues with significant expression in the nucleus of eukaryotic cells. Its role as a histone acetyltransferase places it as an important player in transcriptional activation by modifying the chromatin to a more open conformation facilitating access by transcription machinery.
Biological function summary

KAT2A/GCN5 participates in several cellular processes as part of larger protein complexes. It is a component of the SAGA (Spt-Ada-Gcn5 acetyltransferase) and TFTC (TBP-free TAF-containing complex) both involved in transcription regulation. Through these complexes KAT2A influences gene expression by acetylating histone residues which in turn affects the recruitment of other transcriptional activators or repressors. This activity also links it to non-histone substrates that support DNA damage repair and cellular senescence.

Pathways

KAT2A/GCN5 is integrally connected to the regulation of transcription and chromatin remodeling pathways. It interacts closely with the transcription factor c-Myc assisting in cell cycle regulation and proliferation. Additionally its presence in the p53 signaling pathway highlights its involvement in controlling cell growth and apoptosis. KAT2A/GCN5 activity influences downstream events in these pathways by affecting the acetylation state of specific histones and non-histone proteins.

The dysregulation of KAT2A/GCN5 is linked to cancer particularly in breast and colorectal cancers. Its role in acetylating key proteins like c-Myc and affecting pathways like p53 can lead to unchecked cell growth when improperly regulated. Furthermore KAT2A is connected to neurodegenerative diseases through its interactions with other histone modifiers such as HDAC1 and HDAC2 implicating it in conditions where neural cell function or maintenance goes awry.

Specifications

Form

Liquid

Additional notes

ab111648 is purified using conventional chromatography.

General info

Function

Protein lysine acyltransferase that can act as a acetyltransferase, glutaryltransferase, succinyltransferase or malonyltransferase, depending on the context (PubMed : 29211711, PubMed : 35995428). Acts as a histone lysine succinyltransferase : catalyzes succinylation of histone H3 on 'Lys-79' (H3K79succ), with a maximum frequency around the transcription start sites of genes (PubMed : 29211711). Succinylation of histones gives a specific tag for epigenetic transcription activation (PubMed : 29211711). Association with the 2-oxoglutarate dehydrogenase complex, which provides succinyl-CoA, is required for histone succinylation (PubMed : 29211711). In different complexes, functions either as an acetyltransferase (HAT) or as a succinyltransferase : in the SAGA and ATAC complexes, acts as a histone acetyltransferase (PubMed : 17301242, PubMed : 19103755, PubMed : 29211711). Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles (PubMed : 17301242, PubMed : 19103755, PubMed : 21131905). Has a a strong preference for acetylation of H3 at 'Lys-9' (H3K9ac) (PubMed : 21131905). Acetylation of histones gives a specific tag for epigenetic transcription activation (PubMed : 17301242, PubMed : 19103755, PubMed : 29211711). Recruited by the XPC complex at promoters, where it specifically mediates acetylation of histone variant H2A.Z.1/H2A.Z, thereby promoting expression of target genes (PubMed : 29973595, PubMed : 31527837). Involved in long-term memory consolidation and synaptic plasticity : acts by promoting expression of a hippocampal gene expression network linked to neuroactive receptor signaling (By similarity). Acts as a positive regulator of T-cell activation : upon TCR stimulation, recruited to the IL2 promoter following interaction with NFATC2 and catalyzes acetylation of histone H3 at 'Lys-9' (H3K9ac), leading to promote IL2 expression (By similarity). Required for growth and differentiation of craniofacial cartilage and bone by regulating acetylation of histone H3 at 'Lys-9' (H3K9ac) (By similarity). Regulates embryonic stem cell (ESC) pluripotency and differentiation (By similarity). Also acetylates non-histone proteins, such as CEBPB, MRE11, PPARGC1A, PLK4 and TBX5 (PubMed : 16753578, PubMed : 17301242, PubMed : 27796307, PubMed : 29174768, PubMed : 38128537). Involved in heart and limb development by mediating acetylation of TBX5, acetylation regulating nucleocytoplasmic shuttling of TBX5 (PubMed : 29174768). Acts as a negative regulator of centrosome amplification by mediating acetylation of PLK4 (PubMed : 27796307). Acts as a negative regulator of gluconeogenesis by mediating acetylation and subsequent inactivation of PPARGC1A (PubMed : 16753578, PubMed : 23142079). Also acts as a histone glutaryltransferase : catalyzes glutarylation of histone H4 on 'Lys-91' (H4K91glu), a mark that destabilizes nucleosomes by promoting dissociation of the H2A-H2B dimers from nucleosomes (PubMed : 31542297).. (Microbial infection) In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes.

Sequence similarities

Belongs to the acetyltransferase family. GCN5 subfamily.

Post-translational modifications

Acetylated at Lys-549, inhibiting the protein acetyltransferase activity (PubMed:23142079). Deacetylation at Lys-549 by SIRT6 promotes phosphorylation at Ser-307 and Thr-735 and subsequent activation of the protein acetyltransferase activity, leading to acetylation and inactivation of PPARGC1A (PubMed:23142079).

Subcellular localisation

Nucleus

Product protocols

Target data

Protein lysine acyltransferase that can act as a acetyltransferase, glutaryltransferase, succinyltransferase or malonyltransferase, depending on the context (PubMed : 29211711, PubMed : 35995428). Acts as a histone lysine succinyltransferase : catalyzes succinylation of histone H3 on 'Lys-79' (H3K79succ), with a maximum frequency around the transcription start sites of genes (PubMed : 29211711). Succinylation of histones gives a specific tag for epigenetic transcription activation (PubMed : 29211711). Association with the 2-oxoglutarate dehydrogenase complex, which provides succinyl-CoA, is required for histone succinylation (PubMed : 29211711). In different complexes, functions either as an acetyltransferase (HAT) or as a succinyltransferase : in the SAGA and ATAC complexes, acts as a histone acetyltransferase (PubMed : 17301242, PubMed : 19103755, PubMed : 29211711). Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles (PubMed : 17301242, PubMed : 19103755, PubMed : 21131905). Has a a strong preference for acetylation of H3 at 'Lys-9' (H3K9ac) (PubMed : 21131905). Acetylation of histones gives a specific tag for epigenetic transcription activation (PubMed : 17301242, PubMed : 19103755, PubMed : 29211711). Recruited by the XPC complex at promoters, where it specifically mediates acetylation of histone variant H2A.Z.1/H2A.Z, thereby promoting expression of target genes (PubMed : 29973595, PubMed : 31527837). Involved in long-term memory consolidation and synaptic plasticity : acts by promoting expression of a hippocampal gene expression network linked to neuroactive receptor signaling (By similarity). Acts as a positive regulator of T-cell activation : upon TCR stimulation, recruited to the IL2 promoter following interaction with NFATC2 and catalyzes acetylation of histone H3 at 'Lys-9' (H3K9ac), leading to promote IL2 expression (By similarity). Required for growth and differentiation of craniofacial cartilage and bone by regulating acetylation of histone H3 at 'Lys-9' (H3K9ac) (By similarity). Regulates embryonic stem cell (ESC) pluripotency and differentiation (By similarity). Also acetylates non-histone proteins, such as CEBPB, MRE11, PPARGC1A, PLK4 and TBX5 (PubMed : 16753578, PubMed : 17301242, PubMed : 27796307, PubMed : 29174768, PubMed : 38128537). Involved in heart and limb development by mediating acetylation of TBX5, acetylation regulating nucleocytoplasmic shuttling of TBX5 (PubMed : 29174768). Acts as a negative regulator of centrosome amplification by mediating acetylation of PLK4 (PubMed : 27796307). Acts as a negative regulator of gluconeogenesis by mediating acetylation and subsequent inactivation of PPARGC1A (PubMed : 16753578, PubMed : 23142079). Also acts as a histone glutaryltransferase : catalyzes glutarylation of histone H4 on 'Lys-91' (H4K91glu), a mark that destabilizes nucleosomes by promoting dissociation of the H2A-H2B dimers from nucleosomes (PubMed : 31542297).. (Microbial infection) In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes.
See full target information KAT2A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com