JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114456

Recombinant Human Kir4.1/KCNJ10 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Kir4.1/KCNJ10 protein (GST tag N-Terminus) is a Human Fragment protein, in the 276 to 379 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

ATP-sensitive inward rectifier potassium channel 10, ATP-dependent inwardly rectifying potassium channel Kir4.1, Inward rectifier K(+) channel Kir1.2, KCNJ10

1 Images
SDS-PAGE - Recombinant Human Kir4.1/KCNJ10 protein (GST tag N-Terminus) (AB114456)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Kir4.1/KCNJ10 protein (GST tag N-Terminus) (AB114456)

ab114456 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

P78508

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Kir4.1.

Sequence info

[{"sequence":"DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV","proteinLength":"Fragment","predictedMolecularWeight":"37.07 kDa","actualMolecularWeight":null,"aminoAcidEnd":379,"aminoAcidStart":276,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P78508","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Kir4.1 also known as KCNJ10 is an inwardly rectifying potassium channel. It is a protein with a mass of approximately 45 kDa. Kir4.1 facilitates the movement of potassium ions across the cell membrane helping maintain the membrane potential in certain cells. This channel prominently expresses in the brain kidney and inner ear. In glial cells of the central nervous system it plays an important role in maintaining potassium homeostasis. This is important for the correct functioning of neurons and other glial cells.
Biological function summary

The potassium channel Kir4.1 functions to balance potassium levels in the extracellular space which is important for nerve impulse propagation and muscle contraction. Kir4.1 frequently forms a complex with another potassium channel Kir5.1 (KCNJ16). Together these complexes contribute to fine-tuning the electrochemical gradient impacting various cell types. Its distribution and activity affect neuronal signaling renal function and endolymph generation in the ear.

Pathways

Kir4.1 plays essential roles in neural signaling pathways and renal reabsorption processes. This target interacts with proteins like AQP4 in the brain influencing water transport and ion homeostasis. Its functionality is part of the regulatory mechanisms within the distal convoluted tubule of the kidney impacting water and salt balance. These interactions facilitate proper electrical signaling and osmoregulation in the body.

Kir4.1 has associations with disorders such as epilepsy and EAST syndrome. Defects or dysregulation in the Kir4.1 channel can disrupt potassium ion balance which may lead to abnormal neuronal excitability manifesting as epilepsy. Additionally mutations in this channel can contribute to EAST syndrome a condition involving epilepsy ataxia sensorineural deafness and renal tubulopathy. Related proteins like AQP4 can also be implicated highlighting the complexity of physiological processes involving Kir4.1.

Specifications

Form

Liquid

General info

Function

May be responsible for potassium buffering action of glial cells in the brain (By similarity). Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it (PubMed : 8995301). Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages (PubMed : 8995301). The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (PubMed : 8995301). In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules (PubMed : 24561201).

Sequence similarities

Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ10 subfamily.

Product protocols

Target data

May be responsible for potassium buffering action of glial cells in the brain (By similarity). Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it (PubMed : 8995301). Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages (PubMed : 8995301). The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (PubMed : 8995301). In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules (PubMed : 24561201).
See full target information KCNJ10

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com