JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB196432

Recombinant human KMT5A / SETD8 / Pr-SET7 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human KMT5A / SETD8 / Pr-SET7 protein (GST tag N-Terminus) is a Human Fragment protein, in the 195 to 352 aa range, expressed in Escherichia coli, with >84%, suitable for SDS-PAGE, FuncS.

View Alternative Names

PRSET7, SET07, SET8, SETD8, KMT5A, N-lysine methyltransferase KMT5A, H4-K20-HMTase KMT5A, Histone-lysine N-methyltransferase KMT5A, Lysine N-methyltransferase 5A, Lysine-specific methylase 5A, PR/SET domain-containing protein 07, SET domain-containing protein 8, PR-Set7, PR/SET07

2 Images
Functional Studies - Recombinant human KMT5A / SETD8 / Pr-SET7 protein (GST tag N-Terminus) (AB196432)
  • FuncS

Supplier Data

Functional Studies - Recombinant human KMT5A / SETD8 / Pr-SET7 protein (GST tag N-Terminus) (AB196432)

Specific activity of ab196432.

SDS-PAGE - Recombinant human KMT5A / SETD8 / Pr-SET7 protein (GST tag N-Terminus) (AB196432)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human KMT5A / SETD8 / Pr-SET7 protein (GST tag N-Terminus) (AB196432)

SDS-PAGE analysis of 7.5 μg of ab196432 on a 4-20% SDS-PAGE gel stained with Coomassie.

Key facts

Purity

>84% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

50 μl reaction mix (50 mM Tris, pH 8.8, 1 mM EDTA, 1 mM DTT, 40 μM S-adenosylhomocysteine, and 0-6 μg ab196432) is added to the wells coated with the substrate. Incubate for 2 hr. Add antibody against methylated residue of histone H4, incubate 1 hr. Then, add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminsecent substrates and read luminescence.

Accession

Q9NQR1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.49% Glutathione, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH","proteinLength":"Fragment","predictedMolecularWeight":"44 kDa","actualMolecularWeight":null,"aminoAcidEnd":352,"aminoAcidStart":195,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NQR1","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

KMT5A also known as SETD8 or Pr-SET7 is a histone methyltransferase enzyme with a notable role in regulating chromatin dynamics. It specifically catalyzes the monomethylation of histone H4 at lysine 20 (H4K20me1) a modification linked to chromatin compaction and DNA damage response. The molecular mass of KMT5A is approximately 47 kDa. Expression of KMT5A is observed in various tissues including the liver kidney and to some extent in embryonic stem cells indicating its functionality across different stages of development and cell types.
Biological function summary

KMT5A's activity influences several essential cellular processes such as cell cycle progression and DNA repair. As part of a larger chromatin-modulating framework it often functions alongside other chromatin-associated proteins including those from the Polycomb group. It plays a significant role in maintaining genomic stability by marking specific regions of chromatin for certain functions thereby affecting transcription regulation and cellular growth.

Pathways

KMT5A integrates into critical biological mechanisms like the DNA damage response and cell cycle regulation. It links closely with pathways involving p53 and cyclin-dependent kinase (CDK) inhibitors. KMT5A’s histone modification activity influences proteins such as p21 and p16 within the DNA damage signaling network. Its regulatory role here is essential as it facilitates an environment conducive to the DNA repair machinery following genotoxic stress.

KMT5A connects to various pathological states notably cancer and neurodegenerative disorders. Misregulation of KMT5A activity is associated with tumorigenesis where altered levels of H4K20me1 can lead to abnormal cell proliferation. Additionally KMT5A interacts through pathways tied to protein like TP53 influencing cellular responses to stressors typically seen in oncogenesis. Similarly aberrant regulation has implications in cognitive impairments potentially through dysregulated methylation patterns affecting neuronal cell cycle re-entry.

Specifications

Form

Liquid

General info

Function

Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins (PubMed : 12086618, PubMed : 12121615, PubMed : 15964846, PubMed : 17707234, PubMed : 27338793). Specifically monomethylates 'Lys-20' of histone H4 (H4K20me1) (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599, PubMed : 27338793). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Required for cell proliferation, probably by contributing to the maintenance of proper higher-order structure of DNA during mitosis (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Involved in chromosome condensation and proper cytokinesis (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Nucleosomes are preferred as substrate compared to free histones (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Mediates monomethylation of p53/TP53 at 'Lys-382', leading to repress p53/TP53-target genes (PubMed : 17707234). Plays a negative role in TGF-beta response regulation and a positive role in cell migration (PubMed : 23478445).

Sequence similarities

Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. PR/SET subfamily.

Post-translational modifications

Acetylated at Lys-162; does not affect methyltransferase activity. Deacetylated at Lys-162 possibly by SIRT2; does not change methyltransferase activity.. Ubiquitinated and degraded by the DCX(DTL) complex.

Subcellular localisation

Nucleus

Product protocols

Target data

Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins (PubMed : 12086618, PubMed : 12121615, PubMed : 15964846, PubMed : 17707234, PubMed : 27338793). Specifically monomethylates 'Lys-20' of histone H4 (H4K20me1) (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599, PubMed : 27338793). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Required for cell proliferation, probably by contributing to the maintenance of proper higher-order structure of DNA during mitosis (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Involved in chromosome condensation and proper cytokinesis (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Nucleosomes are preferred as substrate compared to free histones (PubMed : 12086618, PubMed : 12121615, PubMed : 15200950, PubMed : 15933069, PubMed : 15933070, PubMed : 15964846, PubMed : 16517599). Mediates monomethylation of p53/TP53 at 'Lys-382', leading to repress p53/TP53-target genes (PubMed : 17707234). Plays a negative role in TGF-beta response regulation and a positive role in cell migration (PubMed : 23478445).
See full target information KMT5A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com