JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114626

Recombinant Human KPNA4 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human KPNA4 protein is a Human Full Length protein, in the 1 to 521 aa range, expressed in Wheat germ, with >80%, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

QIP1, KPNA4, Importin subunit alpha-3, Importin alpha Q1, Karyopherin subunit alpha-4, Qip1

1 Images
SDS-PAGE - Recombinant Human KPNA4 protein (AB114626)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human KPNA4 protein (AB114626)

ab114626 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

Key facts

Purity

>80%

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

O00629

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF","proteinLength":"Full Length","predictedMolecularWeight":"83.38 kDa","actualMolecularWeight":null,"aminoAcidEnd":521,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O00629","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

KPNA4 also known as importin alpha 4 or karyopherin subunit alpha 4 is a protein involved in nuclear transport mechanisms. It has a molecular weight of approximately 58 kDa. KPNA4 finds expression in various tissues including the brain immune cells and reproductive organs. This protein belongs to the family of karyopherins which mediates the import of proteins into the nucleus by recognizing nuclear localization signals.
Biological function summary

KPNA4 plays a role in transporting proteins into the nucleus as part of the importin complex. This complex forms through the association of KPNA4 with importin beta facilitating the translocation of cargo proteins through the nuclear pore complex. This translocation process is essential for regulating gene expression and cellular functions as proteins must reach the cell nucleus to execute their roles. KPNA4 interacts with various cargo proteins allowing them to partake in nuclear activities essential for cellular activity and response.

Pathways

KPNA4 participates in the nuclear import pathway closely linking with the Ran GTPase cycle. This pathway is important for transporting macromolecules between the cytoplasm and nucleus. KPNA4's action complements the function of the importin beta family where it co-transports with proteins like Ran and importin beta ensuring effective and specific nuclear import of karyophilic proteins. The presence of KPNA4 in these pathways highlights its importance in cellular regulation and response paths.

KPNA4 shows connections to neurodegenerative diseases and certain cancers suggesting its potential role in these conditions. In neurodegenerative diseases its association with proteins involved in intracellular transport could imply a role in pathological processes where nuclear-cytoplasmic trafficking is disrupted. Furthermore KPNA4's interaction with proteins like importin beta in cancer could influence tumor progression through altered nuclear transport impacting gene expression and cell cycle regulation. Recognizing these associations might provide insights for therapeutic targeting or diagnostic markers in related conditions.

Specifications

Form

Liquid

Additional notes

Glutathione Sepharose

General info

Function

Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1 (PubMed : 10567565, PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). Binds specifically and directly to substrates containing either a simple or bipartite NLS motif (PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism (PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin (PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). Mediates nuclear import of AARS1, MRTFA and RANBP3 (PubMed : 10567565, PubMed : 20818336, PubMed : 28760339, PubMed : 38512451).. (Microbial infection) In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.

Sequence similarities

Belongs to the importin alpha family.

Subcellular localisation

Nucleus

Product protocols

Target data

Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1 (PubMed : 10567565, PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). Binds specifically and directly to substrates containing either a simple or bipartite NLS motif (PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism (PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin (PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (PubMed : 20818336, PubMed : 28760339, PubMed : 29042532, PubMed : 38512451). Mediates nuclear import of AARS1, MRTFA and RANBP3 (PubMed : 10567565, PubMed : 20818336, PubMed : 28760339, PubMed : 38512451).. (Microbial infection) In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.
See full target information KPNA4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com