JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB199581

Recombinant Human KPNA5 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human KPNA5 protein (Tagged) is a Human Full Length protein, in the 1 to 536 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

Importin subunit alpha-6, Karyopherin subunit alpha-5, KPNA5

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O15131

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MASMTGGQQMGRGHHHHHHGNLYFQGGEFDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL","proteinLength":"Full Length","predictedMolecularWeight":"63.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":536,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O15131","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein KPNA5 also known as importin alpha 5 belongs to the karyopherin alpha family. Mechanically it plays an important role in the nuclear import of proteins by recognizing and binding to nuclear localization signals (NLS) on cargo proteins. Importin alpha 5 acts as an adaptor bridging cargo proteins with importin beta which facilitates transport through the nuclear pore complex. KPNA5 has a molecular mass of approximately 60 kDa and is expressed in a wide range of tissues including the brain heart and pancreas indicating its involvement in various cellular processes.
Biological function summary

KPNA5 is important in the transportation of proteins across the nuclear envelope a process that regulates many cellular functions such as cell division signal transduction and transcriptional control. KPNA5 as part of the importin alpha/beta complex regulates the import of proteins like transcription factors and tumor suppressors into the nucleus. The efficient functioning of this complex ensures proper cellular responses and maintenance of cellular homeostasis. By controlling the nuclear-cytoplasmic transport KPNA5 facilitates the precise localization of proteins necessary for normal cell function.

Pathways

KPNA5 is involved in the nuclear transport pathway and is closely associated with the nucleocytoplasmic transport pathway. It interacts with proteins such as importin beta1 for translocation through the nuclear pore complex. This interaction is essential for processes like the regulation of gene expression and signal-dependent nuclear import which are critical for maintaining cellular activities and responses. The precise regulation of these pathways ensures that cells respond appropriately to different physiological signals and stresses.

KPNA5 shows a connection to certain cancers and neurodegenerative diseases. Its role in nuclear-cytoplasmic transport can influence oncogenesis as disruption in the import of cancer-related proteins could lead to tumor progression. Additionally abnormal KPNA5 function may associate with neurodegenerative conditions where impaired protein transport affects neuronal health. In such disorders KPNA5 often interacts with tumor suppressor proteins and other proteins that are important for neuronal function illustrating its potential as a target for therapeutic intervention.

Specifications

Form

Liquid

Additional notes

ab199581 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.

General info

Function

Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates nuclear import of STAT1 homodimers and STAT1/STAT2 heterodimers by recognizing non-classical NLSs of STAT1 and STAT2 through ARM repeats 8-9. Recognizes influenza A virus nucleoprotein through ARM repeat 7-9 In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.

Sequence similarities

Belongs to the importin alpha family.

Product protocols

Target data

Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates nuclear import of STAT1 homodimers and STAT1/STAT2 heterodimers by recognizing non-classical NLSs of STAT1 and STAT2 through ARM repeats 8-9. Recognizes influenza A virus nucleoprotein through ARM repeat 7-9 In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.
See full target information KPNA5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com