JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB314698

Recombinant Human KRAS (mutated G12V) Protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human KRAS (mutated G12V) Protein (His tag) is a Human Full Length protein, in the 2 to 186 aa range, expressed in Escherichia coli, with >95%, >0.005 EU/µg endotoxin level, suitable for HPLC, Mass Spec.

View Alternative Names

KRAS2, RASK2, KRAS, GTPase KRas, K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras

2 Images
Mass Spectrometry - Recombinant Human KRAS (mutated G12V) Protein (His tag) (AB314698)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant Human KRAS (mutated G12V) Protein (His tag) (AB314698)

Mass determination by ESI-TOF. Predicted MW is 23400.00 Da (+/-10 Da by ESI-TOF). Observed MW is 23241.96

HPLC - Recombinant Human KRAS (mutated G12V) Protein (His tag) (AB314698)
  • HPLC

Lab

HPLC - Recombinant Human KRAS (mutated G12V) Protein (His tag) (AB314698)

HPLC analysis of ab314698

Key facts

Purity

>95% HPLC

Endotoxin level

>0.005 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, HPLC

applications

Biologically active

No

Mass Spectrometry

LC-MS/MS

Accession

P01116

Animal free

Yes

Carrier free

No

Species

Human

Storage buffer

pH: 7 Constituents: 20% Glycerol (glycerin, glycerine), 1.4586% Sodium chloride, 0.2691% Disodium hydrogenorthophosphate, 0.1629% Sodium Phosphate Monobasic, 0.0148% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"TEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKC","proteinLength":"Full Length","predictedMolecularWeight":"23.4 kDa","actualMolecularWeight":"23.24 kDa","aminoAcidEnd":186,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01116","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The KRAS protein also known as Kirsten rat sarcoma viral oncogene homolog is a small GTPase weighing around 21 kDa. It plays an important role in cell signaling pathways and is widely expressed in various tissues. As a molecular switch KRAS cycles between an active GTP-bound state and an inactive GDP-bound state regulating cell proliferation differentiation and survival. KRAS mutations are often studied using various cell lines including the HCT116 line which is a human colorectal carcinoma cell line with a KRAS mutant background. Western blot analysis commonly helps in investigating KRAS protein expression and activity levels.
Biological function summary

KRAS influences many cellular processes. It is not part of a complex but acts alone within its pathways. It modulates signal transduction processes which are significant for the control of proliferation apoptosis and cell cycle progress. Mutations within this protein such as KRAS G12V and KRAS G12D lead to continuous activation and can cause uncontrolled cell growth which links them to various cancers. KRAS commonly interacts with proteins like RAF kinase and PI3K signaling components to execute its functions.

Pathways

KRAS is an important component in at least two important signaling pathways: the MAPK/ERK pathway and the PI3K/AKT pathway. These pathways play major roles in regulating gene expression that drives cell growth and division. In the MAPK/ERK pathway KRAS activates RAF which subsequently initiates a phosphorylation cascade that stimulates ERK. This protein also interacts with elements of the PI3K/AKT pathway influencing cellular survival and metabolism. These interactions position KRAS as a vital oncogene in cancer biology.

KRAS mutations are important in the development and progression of colorectal and pancreatic cancers. The persistence of active KRAS leads to continuous signaling that drives tumor growth and resistance to apoptosis. KRAS-associated cancers often show poor prognosis partly due to limited therapeutic options. Its interaction with proteins like EGFR (Epidermal Growth Factor Receptor) in various cancers highlights complex treatment challenges as these proteins can provide alternative signaling routes further complicating disease management.

Specifications

Form

Liquid

General info

Function

The protein expressed by the KRAS gene binds GDP/GTP and has intrinsic GTPase activity. It plays an important role in regulating cell proliferation and may contribute to oncogenic events by inducing transcriptional silencing of tumor suppressor genes in colorectal cancer cells through a ZNF304-dependent mechanism. This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the small GTPase superfamily. Ras family.

Post-translational modifications

Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs).. Palmitoylated at Lys-182, Lys-184 and Lys-185 (PubMed:29239724). Palmitoylation on lysine residues is promoted by palmitoylation at Cys-180 (PubMed:29239724). Lysine-depalmitoylation by SIRT2 promotes its localization to endomembranes in endocytic pathways (PubMed:29239724).. Ubiquitinated by the BCR(LZTR1) E3 ubiquitin ligase complex at Lys-170 in a non-degradative manner, leading to inhibit Ras signaling by decreasing Ras association with membranes.. (Microbial infection) Glucosylated at Thr-35 by P.sordellii toxin TcsL.

Product protocols

For this product, it's our understanding that no specific protocols are required. You can visit:

Target data

The protein expressed by the KRAS gene binds GDP/GTP and has intrinsic GTPase activity. It plays an important role in regulating cell proliferation and may contribute to oncogenic events by inducing transcriptional silencing of tumor suppressor genes in colorectal cancer cells through a ZNF304-dependent mechanism. This supplementary information is collated from multiple sources and compiled automatically.
See full target information KRAS mutated G12V

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com