JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB96817

Recombinant Human KRAS (mutated Q61H) protein (His tag N-Terminus)

5

(2 Reviews)

|

(6 Publications)

Recombinant Human KRAS (mutated Q61H) protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 185 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec, WB.

View Alternative Names

KRAS2, RASK2, KRAS, GTPase KRas, K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras

3 Images
Mass Spectrometry - Recombinant Human KRAS (mutated Q61H) protein (AB96817)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human KRAS (mutated Q61H) protein (AB96817)

MALTI-TOF result : of 23253.422 Da for Human KRAS (mutated Q61H) protein.

Western blot - Recombinant Human KRAS (mutated Q61H) protein (His tag N-Terminus) (AB96817)
  • WB

Unknown

Western blot - Recombinant Human KRAS (mutated Q61H) protein (His tag N-Terminus) (AB96817)

This blot was produced using a 4-12% Bis-tris gel under the MES buffer system. The gel was run at 200V for 35 minutes before being transferred onto a Nitrocellulose membrane at 30V for 70 minutes. The membrane was then blocked for an hour using 5% Bovine Serum Albumin before being incubated with ab84573 overnight at 4°C. Antibody binding was detected using an anti-rabbit antibody conjugated to HRP, and visualised using ECL development solution.

All lanes:

Anti-Ras antibody (<a href='/en-us/products/unavailable/ras-antibody-ab84573'>ab84573</a>) at 1 µg/mL

All lanes:

Western blot - Recombinant Human KRAS (mutated Q61H) protein (His tag N-Terminus) (ab96817) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

true

Exposure time: 4min

SDS-PAGE - Recombinant Human KRAS (mutated Q61H) protein (AB96817)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human KRAS (mutated Q61H) protein (AB96817)

15% SDS-PAGE showing ab96817 at approximately 23.2 kDa (3 μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

WB, SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P01116

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Ab96817can be used as a WB positive control in conjunction with <a href='/en-us/products/unavailable/ras-antibody-ab84573'>ab84573</a>.</p>" } } }

Product details

Isoform 2B

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC","proteinLength":"Full Length","predictedMolecularWeight":"23.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":185,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01116","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The KRAS protein also known as Kirsten rat sarcoma viral oncogene homolog is a small GTPase weighing around 21 kDa. It plays an important role in cell signaling pathways and is widely expressed in various tissues. As a molecular switch KRAS cycles between an active GTP-bound state and an inactive GDP-bound state regulating cell proliferation differentiation and survival. KRAS mutations are often studied using various cell lines including the HCT116 line which is a human colorectal carcinoma cell line with a KRAS mutant background. Western blot analysis commonly helps in investigating KRAS protein expression and activity levels.
Biological function summary

KRAS influences many cellular processes. It is not part of a complex but acts alone within its pathways. It modulates signal transduction processes which are significant for the control of proliferation apoptosis and cell cycle progress. Mutations within this protein such as KRAS G12V and KRAS G12D lead to continuous activation and can cause uncontrolled cell growth which links them to various cancers. KRAS commonly interacts with proteins like RAF kinase and PI3K signaling components to execute its functions.

Pathways

KRAS is an important component in at least two important signaling pathways: the MAPK/ERK pathway and the PI3K/AKT pathway. These pathways play major roles in regulating gene expression that drives cell growth and division. In the MAPK/ERK pathway KRAS activates RAF which subsequently initiates a phosphorylation cascade that stimulates ERK. This protein also interacts with elements of the PI3K/AKT pathway influencing cellular survival and metabolism. These interactions position KRAS as a vital oncogene in cancer biology.

KRAS mutations are important in the development and progression of colorectal and pancreatic cancers. The persistence of active KRAS leads to continuous signaling that drives tumor growth and resistance to apoptosis. KRAS-associated cancers often show poor prognosis partly due to limited therapeutic options. Its interaction with proteins like EGFR (Epidermal Growth Factor Receptor) in various cancers highlights complex treatment challenges as these proteins can provide alternative signaling routes further complicating disease management.

Specifications

Form

Liquid

Additional notes

ab96817 is purified using conventional chromatography techniques.

General info

Function

The protein expressed by the KRAS gene binds GDP/GTP and has intrinsic GTPase activity. It plays an important role in regulating cell proliferation and may contribute to oncogenic events by inducing transcriptional silencing of tumor suppressor genes in colorectal cancer cells through a ZNF304-dependent mechanism. This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the small GTPase superfamily. Ras family.

Post-translational modifications

Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs).. Palmitoylated at Lys-182, Lys-184 and Lys-185 (PubMed:29239724). Palmitoylation on lysine residues is promoted by palmitoylation at Cys-180 (PubMed:29239724). Lysine-depalmitoylation by SIRT2 promotes its localization to endomembranes in endocytic pathways (PubMed:29239724).. Ubiquitinated by the BCR(LZTR1) E3 ubiquitin ligase complex at Lys-170 in a non-degradative manner, leading to inhibit Ras signaling by decreasing Ras association with membranes.. (Microbial infection) Glucosylated at Thr-35 by P.sordellii toxin TcsL.

Product protocols

Target data

The protein expressed by the KRAS gene binds GDP/GTP and has intrinsic GTPase activity. It plays an important role in regulating cell proliferation and may contribute to oncogenic events by inducing transcriptional silencing of tumor suppressor genes in colorectal cancer cells through a ZNF304-dependent mechanism. This supplementary information is collated from multiple sources and compiled automatically.
See full target information KRAS mutated Q61H

Publications (6)

Recent publications for all applications. Explore the full list and refine your search

Scientific reports 10:21671 PubMed33303890

2020

Generation of KS-58 as the first K-Ras(G12D)-inhibitory peptide presenting anti-cancer activity in vivo.

Applications

Unspecified application

Species

Unspecified reactive species

Kotaro Sakamoto,Teruaki Masutani,Takatsugu Hirokawa

Cell reports 29:3448-3459.e6 PubMed31825828

2019

DIRAS3 (ARHI) Blocks RAS/MAPK Signaling by Binding Directly to RAS and Disrupting RAS Clusters.

Applications

Unspecified application

Species

Unspecified reactive species

Margie N Sutton,Zhen Lu,Yao-Cheng Li,Yong Zhou,Tao Huang,Albert S Reger,Amy M Hurwitz,Timothy Palzkill,Craig Logsdon,Xiaowen Liang,Joe W Gray,Xiaolin Nan,John Hancock,Geoffrey M Wahl,Robert C Bast

Frontiers in pharmacology 8:823 PubMed29184501

2017

Identification of a New Potent Inhibitor Targeting KRAS in Non-small Cell Lung Cancer Cells.

Applications

Unspecified application

Species

Unspecified reactive species

Chun Xie,Ying Li,Lan-Lan Li,Xing-Xing Fan,Yu-Wei Wang,Chun-Li Wei,Liang Liu,Elaine Lai-Han Leung,Xiao-Jun Yao

Nature communications 8:1123 PubMed29066722

2017

BCL-X directly modulates RAS signalling to favour cancer cell stemness.

Applications

Unspecified application

Species

Unspecified reactive species

Sophie de Carné Trécesson,Frédérique Souazé,Agnès Basseville,Anne-Charlotte Bernard,Jessie Pécot,Jonathan Lopez,Margaux Bessou,Kristopher A Sarosiek,Anthony Letai,Sophie Barillé-Nion,Isabelle Valo,Olivier Coqueret,Catherine Guette,Mario Campone,Fabien Gautier,Philippe Paul Juin

Nature genetics 48:53-8 PubMed26595770

2015

The noncoding RNAs SNORD50A and SNORD50B bind K-Ras and are recurrently deleted in human cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Zurab Siprashvili,Dan E Webster,Danielle Johnston,Rajani M Shenoy,Alexander J Ungewickell,Aparna Bhaduri,Ross Flockhart,Brian J Zarnegar,Yonglu Che,Francesca Meschi,Joseph D Puglisi,Paul A Khavari

Proteomics. Clinical applications 9:695-705 PubMed25656350

2015

Screening protein isoforms predictive for cancer using immunoaffinity capture and fast LC-MS in PRM mode.

Applications

Unspecified application

Species

Unspecified reactive species

Antoine Lesur,Lina Ancheva,Yeoun Jin Kim,Guy Berchem,Jan van Oostrum,Bruno Domon
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com