JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132946

Recombinant Human Ku80 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Ku80 protein is a Human Full Length protein, in the 1 to 732 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

G22P2, XRCC5, X-ray repair cross-complementing protein 5, 86 kDa subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC box-binding factor 85 kDa subunit, DNA repair protein XRCC5, Ku80, Ku86, Lupus Ku autoantigen protein p86, Nuclear factor IV, Thyroid-lupus autoantigen, X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), CTC85, CTCBF, TLAA

1 Images
SDS-PAGE - Recombinant Human Ku80 protein (AB132946)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Ku80 protein (AB132946)

12.5% SDS-PAGE analysis of ab132946 stained with Coomassie Blue

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

P13010

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADSLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGIALITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI","proteinLength":"Full Length","predictedMolecularWeight":"106.26 kDa","actualMolecularWeight":null,"aminoAcidEnd":732,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P13010","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Ku80 protein also known as Ku p70 Ku antigen p70 and by gene identifiers such as Ku80 hum39 and 5c5 functions critically in DNA repair processes. With a molecular mass of approximately 80 kDa Ku80 is ubiquitously expressed in mammalian cells. It is an important component of the Ku heterodimer working with its partner Ku70 to detect and bind DNA double-strand breaks (DSBs). This action initiates repair by aligning with DNA ends to prevent break processing and sustain genome integrity.
Biological function summary

The Ku80 protein executes an important role in maintaining cellular stability by participating in the non-homologous end joining (NHEJ) pathway. Ku80 forms a complex with DNA-PKcs (DNA-dependent protein kinase catalytic subunit) which activates the kinase to phosphorylate itself and other proteins facilitating the repair of DSBs. Its expression is significant in tissues that undergo high rates of cellular turnover and are experienced with DNA damage where the DNA repair mechanisms are important for regular cell cycle progression.

Pathways

DNA repair and V(D)J recombination are principal domains where Ku80 shows its influence. In the context of DNA repair Ku80's partnership with DNA-PKcs as part of the NHEJ repair pathway is fundamental in fixing DNA damage from environmental insults or normal cellular metabolism. In the immune development process through V(D)J recombination Ku80 partners with other proteins like the Artemis complex to perform programmed DNA rearrangements required for the diversity of immune receptors.

Ku80 has a significant relation to cancer and immune deficiencies. Defects in Ku80 function can lead to increased sensitivity to ionizing radiation and a higher propensity for cancer development because of impaired DNA repair capabilities. Moreover in immune-related disorders inadequate Ku80 performance affects the maturation of lymphocytes leading to immune system malfunction. Its malfunctioning connection with proteins like DNA-PKcs and Artemis highlights its critical roles in both tumor suppression and immune system competence.

Specifications

Form

Liquid

General info

Function

Single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA non-homologous end joining (NHEJ) by recruiting DNA-PK to DNA (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). Required for double-strand break repair and V(D)J recombination (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). Also has a role in chromosome translocation (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). It works in the 3'-5' direction (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). During NHEJ, the XRCC5-XRRC6 dimer performs the recognition step : it recognizes and binds to the broken ends of the DNA and protects them from further resection (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). Binding to DNA may be mediated by XRCC6 (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). The XRCC5-XRRC6 dimer acts as a regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold (PubMed : 11493912, PubMed : 12145306, PubMed : 20383123, PubMed : 7957065, PubMed : 8621488). The XRCC5-XRRC6 dimer is probably involved in stabilizing broken DNA ends and bringing them together (PubMed : 12145306, PubMed : 20383123, PubMed : 7957065, PubMed : 8621488). The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step (PubMed : 12145306, PubMed : 20383123, PubMed : 7957065, PubMed : 8621488). The XRCC5-XRRC6 dimer probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks (PubMed : 20383123). XRCC5 probably acts as the catalytic subunit of 5'-dRP activity, and allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined (PubMed : 20383123). The XRCC5-XRRC6 dimer together with APEX1 acts as a negative regulator of transcription (PubMed : 8621488). In association with NAA15, the XRCC5-XRRC6 dimer binds to the osteocalcin promoter and activates osteocalcin expression (PubMed : 12145306). As part of the DNA-PK complex, involved in the early steps of ribosome assembly by promoting the processing of precursor rRNA into mature 18S rRNA in the small-subunit processome (PubMed : 32103174). Binding to U3 small nucleolar RNA, recruits PRKDC and XRCC5/Ku86 to the small-subunit processome (PubMed : 32103174). Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway (PubMed : 28712728).

Sequence similarities

Belongs to the ku80 family.

Post-translational modifications

ADP-ribosylated by PARP3.. Phosphorylated on serine residues. Phosphorylation by PRKDC may enhance helicase activity.. Sumoylated.. Ubiquitinated by RNF8 via 'Lys-48'-linked ubiquitination following DNA damage, leading to its degradation and removal from DNA damage sites (PubMed:22266820). Ubiquitinated by RNF138, leading to remove the Ku complex from DNA breaks (PubMed:26502055).

Subcellular localisation

Nucleus

Product protocols

Target data

Single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA non-homologous end joining (NHEJ) by recruiting DNA-PK to DNA (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). Required for double-strand break repair and V(D)J recombination (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). Also has a role in chromosome translocation (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). It works in the 3'-5' direction (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). During NHEJ, the XRCC5-XRRC6 dimer performs the recognition step : it recognizes and binds to the broken ends of the DNA and protects them from further resection (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). Binding to DNA may be mediated by XRCC6 (PubMed : 11493912, PubMed : 12145306, PubMed : 7957065, PubMed : 8621488). The XRCC5-XRRC6 dimer acts as a regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold (PubMed : 11493912, PubMed : 12145306, PubMed : 20383123, PubMed : 7957065, PubMed : 8621488). The XRCC5-XRRC6 dimer is probably involved in stabilizing broken DNA ends and bringing them together (PubMed : 12145306, PubMed : 20383123, PubMed : 7957065, PubMed : 8621488). The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step (PubMed : 12145306, PubMed : 20383123, PubMed : 7957065, PubMed : 8621488). The XRCC5-XRRC6 dimer probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks (PubMed : 20383123). XRCC5 probably acts as the catalytic subunit of 5'-dRP activity, and allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined (PubMed : 20383123). The XRCC5-XRRC6 dimer together with APEX1 acts as a negative regulator of transcription (PubMed : 8621488). In association with NAA15, the XRCC5-XRRC6 dimer binds to the osteocalcin promoter and activates osteocalcin expression (PubMed : 12145306). As part of the DNA-PK complex, involved in the early steps of ribosome assembly by promoting the processing of precursor rRNA into mature 18S rRNA in the small-subunit processome (PubMed : 32103174). Binding to U3 small nucleolar RNA, recruits PRKDC and XRCC5/Ku86 to the small-subunit processome (PubMed : 32103174). Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway (PubMed : 28712728).
See full target information XRCC5

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Science advances 9:eade0869 PubMed36630517

2023

Identification of AXL as a co-receptor for human parvovirus B19 infection of human erythroid progenitors.

Applications

Unspecified application

Species

Unspecified reactive species

Kang Ning,Wei Zou,Peng Xu,Fang Cheng,Elizabeth Yan Zhang,Aaron Zhang-Chen,Steve Kleiboeker,Jianming Qiu
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com