JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB101637

Recombinant Human LAMTOR2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LAMTOR2 protein is a Human Full Length protein, in the 1 to 125 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

MAPBPIP, ROBLD3, HSPC003, LAMTOR2, Ragulator complex protein LAMTOR2, Endosomal adaptor protein p14, Late endosomal/lysosomal Mp1-interacting protein, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2, Mitogen-activated protein-binding protein-interacting protein, Roadblock domain-containing protein 3, MAPBP-interacting protein

1 Images
SDS-PAGE - Recombinant Human LAMTOR2 protein (AB101637)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human LAMTOR2 protein (AB101637)

ab101637 (3 µg) analyzed by 15% SDS PAGE.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9Y2Q5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS","proteinLength":"Full Length","predictedMolecularWeight":"16 kDa","actualMolecularWeight":null,"aminoAcidEnd":125,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9Y2Q5","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LAMTOR2 also called p14 acts as an important component of the Ragulator complex. With a molecular mass of approximately 16 kDa LAMTOR2 localizes mainly on the late endosomal and lysosomal membranes. This protein aids in the recruitment of other proteins to these membranes facilitating various cellular processes. The expression of LAMTOR2 finds prominence in many tissues especially those with high metabolic activity.
Biological function summary

LAMTOR2 serves in the regulation of mTORC1 signaling which plays a major role in cell growth and metabolism. As a member of the Ragulator complex LAMTOR2 works in concert with other proteins like LAMTOR1 and LAMTOR3 to anchor the Rag GTPases to the lysosomal surface. This provides a platform for the activation of mTORC1 in response to amino acid availability therefore guiding cellular energy and protein synthesis pathways.

Pathways

LAMTOR2 functions integrally in the amino acid-sensing pathway and impacts the mTOR signaling pathway. The Ragulator complex involving LAMTOR2 interacts with Rag GTPases to activate mTORC1 upon amino acid availability bridging nutrient sensing and cellular metabolism control. In doing so it interacts closely with proteins like RagA/RagB coordinating signals that are critical for growth-related cellular functions.

LAMTOR2 disruptions have links to immunodeficiency and some metabolic conditions. Deficient Ragulator function including LAMTOR2 leads to improper mTOR signaling impacting immune cell function and systemic metabolism. Notably this situation associates with diseases like Charcot-Marie-Tooth disease where LAMTOR2's interaction with LAMTOR3 becomes significant due to affected lysosomal positioning and signaling pathways.

Specifications

Form

Liquid

Additional notes

ab101637 was purified using conventional chromatography techniques.

General info

Function

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed : 20381137, PubMed : 28935770, PubMed : 29107538, PubMed : 29123114, PubMed : 29158492). Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD) : it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane (PubMed : 22980980, PubMed : 28935770, PubMed : 29107538, PubMed : 29123114, PubMed : 29158492, PubMed : 30181260). Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated (PubMed : 22980980, PubMed : 29107538, PubMed : 29123114, PubMed : 29158492). Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2 (By similarity).

Sequence similarities

Belongs to the GAMAD family.

Subcellular localisation

Late endosome membrane

Product protocols

Target data

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed : 20381137, PubMed : 28935770, PubMed : 29107538, PubMed : 29123114, PubMed : 29158492). Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD) : it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane (PubMed : 22980980, PubMed : 28935770, PubMed : 29107538, PubMed : 29123114, PubMed : 29158492, PubMed : 30181260). Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated (PubMed : 22980980, PubMed : 29107538, PubMed : 29123114, PubMed : 29158492). Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2 (By similarity).
See full target information LAMTOR2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com