JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB183247

Recombinant Human LAMTOR4 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LAMTOR4 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 99 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C7orf59, LAMTOR4, Ragulator complex protein LAMTOR4, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4

1 Images
SDS-PAGE - Recombinant Human LAMTOR4 protein (His tag N-Terminus) (AB183247)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human LAMTOR4 protein (His tag N-Terminus) (AB183247)

15% SDS-PAGE analysis of ab183247 (3μg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q0VGL1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as C7orf59.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV","proteinLength":"Full Length","predictedMolecularWeight":"13.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":99,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q0VGL1","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LAMTOR4 also known as late endosomal/lysosomal adaptor and MAPK and MTOR activator 4 is a component of the Ragulator complex. It interacts with specific proteins to anchor the Rag GTPases on lysosomal membranes. LAMTOR4 is a protein with a mass of approximately 11 kDa. Researchers have detected its expression primarily in cellular membranes especially within lysosomes positioning it as key in related processes.
Biological function summary

This protein plays a role in nutrient sensing and cellular growth regulation. LAMTOR4 is part of the Ragulator complex a scaffolding complex essential for the activation of mTORC1 a central regulator of cell growth and metabolism. LAMTOR4 contributes to the recruitment and activation of mTORC1 at the lysosomal surface which is important for the integration of nutrient and energetic signals.

Pathways

LAMTOR4 is involved in the mTOR signaling pathway closely related to cellular metabolism and growth. This protein interacts with other members of the Ragulator complex like LAMTOR1 and LAMTOR2 all connecting in the process of mTORC1 activation. Through the mTOR pathway LAMTOR4 modulates autophagy and anabolic processes therefore maintaining cellular homeostasis.

Alterations in the function of LAMTOR4 have associations with metabolic disorders and cancerous conditions. The regulatory role of LAMTOR4 in mTORC1 activation links it to conditions such as tuberous sclerosis complex where mTOR signaling is disrupted. Alterations in LAMTOR4 and associated proteins like mTOR and other Ragulator complex members can contribute to pathogenesis by disrupting normal cellular growth and metabolism.

Specifications

Form

Liquid

Additional notes

ab183247 is purified using conventional chromatography techniques.

General info

Function

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed : 22980980, PubMed : 28935770, PubMed : 29107538, PubMed : 29158492, PubMed : 30181260). Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD) : it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane (PubMed : 22980980, PubMed : 28935770, PubMed : 29107538, PubMed : 29158492, PubMed : 30181260). Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated (PubMed : 22980980, PubMed : 28935770, PubMed : 29107538, PubMed : 29158492, PubMed : 30181260).

Sequence similarities

Belongs to the LAMTOR4 family.

Post-translational modifications

Phosphorylation at Ser-67 by PKA inhibits Ragulator complex assembly.

Subcellular localisation

Lysosome

Product protocols

Target data

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids (PubMed : 22980980, PubMed : 28935770, PubMed : 29107538, PubMed : 29158492, PubMed : 30181260). Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD) : it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane (PubMed : 22980980, PubMed : 28935770, PubMed : 29107538, PubMed : 29158492, PubMed : 30181260). Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated (PubMed : 22980980, PubMed : 28935770, PubMed : 29107538, PubMed : 29158492, PubMed : 30181260).
See full target information LAMTOR4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com