JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113124

Recombinant Human LAT protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LAT protein is a Human Fragment protein, in the 28 to 233 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Linker for activation of T-cells family member 1, 36 kDa phosphotyrosine adapter protein, p36-38, pp36, LAT

1 Images
SDS-PAGE - Recombinant Human LAT protein (AB113124)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human LAT protein (AB113124)

15% SDS-PAGE analysis of ab113124 (3 μg).
Molecular weight on SDS-PAGE will appear higher.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

O43561

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN","proteinLength":"Fragment","predictedMolecularWeight":"24.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":233,"aminoAcidStart":28,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O43561","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LAT or Linker for Activation of T cells also known as LAT protein is a transmembrane adaptor protein with an approximate molecular mass of 36-38 kDa. This protein is expressed predominantly on T cells and other cells of the lymphoid lineage. LAT is localized to the plasma membrane and contains multiple tyrosine residues which are critical for its function in signal transduction. Its phosphorylation leads to binding of various signaling molecules enabling signal propagation.
Biological function summary

LAT plays an important role in the immune response by facilitating the assembly of signaling complexes important for T cell activation. Upon antigen stimulation LAT becomes phosphorylated mainly at tyrosine residues allowing proteins like Grb2 and PLCγ1 to form a functional signalosome complex. This complex formation is necessary for downstream signaling events that contribute to T cell proliferation differentiation and cytokine production thereby maintaining immune homeostasis and facilitating adaptive immune responses.

Pathways

LAT operates primarily within the T cell receptor (TCR) signaling pathway. The phosphorylation of LAT by ZAP-70 another important signaling protein enables its role as a scaffold bringing together other molecules for signal transduction. It is closely related to proteins like SLP-76 and GADS both of which are essential for the full activation of T cells. These interactions link LAT to broader signaling cascades such as the MAPK and calcium signaling pathways which are essential for mounting an immune response.

LAT dysfunction is linked to both autoimmune diseases and immunodeficiencies. Defective LAT expression or function can lead to conditions like severe combined immunodeficiency (SCID) due to impaired T cell signaling. Additionally abnormal LAT activity may contribute to autoimmune disorders like systemic lupus erythematosus (SLE) where an overactive immune response is present. Proteins such as LAT can interact with others involved in these conditions including PLCγ1 highlighting its central role in both healthy and diseased states of immune regulation.

Specifications

Form

Liquid

Additional notes

ab113124 was purified using conventional chromatography.

General info

Function

Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development (PubMed : 23514740, PubMed : 25907557). Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.

Post-translational modifications

Phosphorylated on tyrosines by ZAP70 upon TCR activation, or by SYK upon other immunoreceptor activation; which leads to the recruitment of multiple signaling molecules. Is one of the most prominently tyrosine-phosphorylated proteins detected following TCR engagement. May be dephosphorylated by PTPRJ. Phosphorylated by ITK leading to the recruitment of VAV1 to LAT-containing complexes.. Palmitoylation of Cys-26 and Cys-29 is required for raft targeting and efficient phosphorylation.. 'Lys-63'-linked ubiquitinated by TRAF6.

Product protocols

Target data

Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development (PubMed : 23514740, PubMed : 25907557). Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.
See full target information LAT

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com