JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB125612

Recombinant human LATS1/WARTS protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human LATS1/WARTS protein is a Human Fragment protein, in the 589 to 1130 aa range, expressed in Baculovirus infected Sf9 cells, with 70%, suitable for SDS-PAGE, WB, FuncS.

View Alternative Names

WARTS, LATS1, Serine/threonine-protein kinase LATS1, Large tumor suppressor homolog 1, WARTS protein kinase, h-warts

4 Images
Functional Studies - Recombinant human LATS1/WARTS protein (AB125612)
  • FuncS

Supplier Data

Functional Studies - Recombinant human LATS1/WARTS protein (AB125612)

The specific activity of LATS1/WARTS (ab125612) was determined to be 1.6 nmol /min/mg as per activity assay protocol.

Functional Studies - Recombinant human LATS1/WARTS protein (AB125612)
  • FuncS

Unknown

Functional Studies - Recombinant human LATS1/WARTS protein (AB125612)

The specific activity of ab125612 was determined to be 1.4 nmol/mg/min by Kinase Assay.

SDS-PAGE - Recombinant human LATS1/WARTS protein (AB125612)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human LATS1/WARTS protein (AB125612)

SDS PAGE analysis of ab125612

SDS-PAGE - Recombinant human LATS1/WARTS protein (AB125612)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human LATS1/WARTS protein (AB125612)

SDS-PAGE analysis of ab125612.

Key facts

Purity

70%

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE, WB

applications

Biologically active

Yes

Biological activity

The specific activity of ab125612 was determined to be 1.4 nmol/mg/min.

Accession

O95835

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

ab204882 (SGK peptide) can be utilized as a substrate for assessing kinase activity

This product was previously labelled as LATS1

Sequence info

[{"sequence":"KEDESEKSYENVDSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV","proteinLength":"Fragment","predictedMolecularWeight":"95 kDa","actualMolecularWeight":null,"aminoAcidEnd":1130,"aminoAcidStart":589,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"O95835","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LATS1/WARTS also known as Large Tumor Suppressor 1 is a serine/threonine protein kinase with a molecular mass of approximately 125 kDa. Its expression is found in various tissue types including skin lung and liver. Mechanically LATS1/WARTS plays a critical role in regulating the cell cycle and maintaining genomic stability. This kinase is an essential part of the Hippo signaling pathway and contributes to controlling the size of organs by inhibiting cell proliferation and promoting apoptosis.
Biological function summary

LATS1/WARTS functions as an important regulator of cellular growth and differentiation. It is part of the Hippo signaling complex which includes proteins like MST1/2 and YAP/TAZ. This complex helps maintain proper tissue homeostasis by modulating gene expression in response to cellular density and mechanical cues. In doing so LATS1/WARTS phosphorylates and inactivates downstream effectors YAP and TAZ preventing them from translocating to the nucleus where they could promote transcription of growth-promoting genes.

Pathways

Scientists have found LATS1/WARTS to be integral to both the Hippo signaling pathway and the cell cycle regulation pathway. Within these pathways LATS1/WARTS interacts closely with proteins such as MOB1 and YAP mediating cellular responses to growth inhibitory signals. By controlling these interactions LATS1/WARTS helps coordinate cell proliferation and apoptosis which is critical for proper developmental processes and prevention of tumor growth.

Dysregulation of LATS1/WARTS function is associated with the development of cancers particularly in the liver and breast. Research also links LATS1/WARTS to neurodegenerative conditions by implicating its role in apoptosis and cell survival. When its kinase activity is compromised the regulatory balance maintained by the Hippo pathway is disrupted potentially leading to unchecked cell proliferation. Connections with proteins such as YAP and TAZ further illustrate its involvement in these pathological conditions showing its importance in maintaining cellular integrity and function.

Specifications

Form

Liquid

Additional notes

Purified by affinity chromatography

General info

Function

Negative regulator of YAP1 in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Acts as a tumor suppressor which plays a critical role in maintenance of ploidy through its actions in both mitotic progression and the G1 tetraploidy checkpoint. Negatively regulates G2/M transition by down-regulating CDK1 kinase activity. Involved in the control of p53 expression. Affects cytokinesis by regulating actin polymerization through negative modulation of LIMK1. May also play a role in endocrine function. Plays a role in mammary gland epithelial cell differentiation, both through the Hippo signaling pathway and the intracellular estrogen receptor signaling pathway by promoting the degradation of ESR1 (PubMed : 28068668).

Sequence similarities

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.

Post-translational modifications

Autophosphorylated and phosphorylated during M-phase of the cell cycle (PubMed:10518011, PubMed:15122335, PubMed:9988268). Phosphorylated by STK3/MST2 at Ser-909 and Thr-1079, which results in its activation (PubMed:15688006). Phosphorylated by MAP4Ks; in parallel to STK3/MST2 and resulting to its activation (PubMed:26437443). Phosphorylation at Ser-464 by NUAK1 and NUAK2 leads to decreased protein level and is required to regulate cellular senescence and cellular ploidy (PubMed:19927127).

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Negative regulator of YAP1 in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Acts as a tumor suppressor which plays a critical role in maintenance of ploidy through its actions in both mitotic progression and the G1 tetraploidy checkpoint. Negatively regulates G2/M transition by down-regulating CDK1 kinase activity. Involved in the control of p53 expression. Affects cytokinesis by regulating actin polymerization through negative modulation of LIMK1. May also play a role in endocrine function. Plays a role in mammary gland epithelial cell differentiation, both through the Hippo signaling pathway and the intracellular estrogen receptor signaling pathway by promoting the degradation of ESR1 (PubMed : 28068668).
See full target information LATS1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Nature cell biology 22:246-256 PubMed32015438

2020

LATS suppresses mTORC1 activity to directly coordinate Hippo and mTORC1 pathways in growth control.

Applications

Unspecified application

Species

Unspecified reactive species

Wenjian Gan,Xiaoming Dai,Xiangpeng Dai,Jun Xie,Shasha Yin,Junjie Zhu,Chen Wang,Yuchen Liu,Jianping Guo,Min Wang,Jing Liu,Jia Hu,Ryan J Quinton,Neil J Ganem,Pengda Liu,John M Asara,Pier Paolo Pandolfi,Yingzi Yang,Zhigang He,Guangping Gao,Wenyi Wei
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com