JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB103506

Recombinant Human LC3B protein

Be the first to review this product! Submit a review

|

(7 Publications)

Recombinant Human LC3B protein is a Human Full Length protein, in the 1 to 140 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

MAP1ALC3, MAP1LC3B, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associated protein 1 light chain 3 beta, MAP1A/MAP1B LC3 B

1 Images
SDS-PAGE - Recombinant Human LC3B protein (AB103506)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human LC3B protein (AB103506)

15% SDS PAGE analysis of ab103506 (3 μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9GZQ8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG","proteinLength":"Full Length","predictedMolecularWeight":"16.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":140,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9GZQ8","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LC3B also known as microtubule-associated protein 1 light chain 3 beta plays an important role in autophagy a process that maintains cellular homeostasis. The LC3B protein with a molecular weight of approximately 14 kDa undergoes lipidation to form LC3-II which associates with autophagosomal membranes. This protein expresses ubiquitously in various tissues including liver muscle and brain. Researchers often detect LC3B using techniques like LC3B western blot and LC3B immunofluorescence due to its function as a marker indicating autophagy levels.
Biological function summary

LC3B contributes significantly to the formation and maturation of autophagosomes. LC3B part of the autophagy-related protein complex binds to autophagic membranes. During this process LC3-I converts to LC3-II a lipid-phosphatidylethanolamine conjugate essential for autophagosome membrane expansion and closure. This mechanism helps remove damaged organelles and misfolded proteins from cells therefore contributing to cellular quality control.

Pathways

LC3B integrates into the autophagy pathway which is critical for cellular adaptive responses to stress. The mammalian target of rapamycin (mTOR) pathway regulates autophagy where mTOR inhibition activates LC3B promoting autophagosome formation. Moreover LC3B operates alongside other proteins like Beclin-1 and ULK1 facilitating the initiation and progression of autophagy under nutrient starvation conditions. These interactions highlight LC3's role in cellular energy balance and survival mechanisms.

LC3B connects with conditions such as cancer and neurodegenerative diseases. Altered autophagy levels mediated by LC3B often associate with tumorigenesis where its dysregulation can affect cancer progression. Furthermore LC3B also links to neurodegenerative diseases like Alzheimer's where impaired autophagy disrupts neuronal function. LC3B interacts with proteins such as p62/SQSTM1 which affects protein aggregate clearance a critical factor in neurodegenerative pathology.

Specifications

Form

Liquid

General info

Function

Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes) (PubMed : 20418806, PubMed : 23209295, PubMed : 28017329). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (PubMed : 23209295, PubMed : 28017329). In response to cellular stress and upon mitochondria fission, binds C-18 ceramides and anchors autophagolysosomes to outer mitochondrial membranes to eliminate damaged mitochondria (PubMed : 22922758). While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (PubMed : 20418806, PubMed : 23209295, PubMed : 28017329). Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway (PubMed : 24089205). Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed : 31006537, PubMed : 31006538). Upon nutrient stress, directly recruits cofactor JMY to the phagophore membrane surfaces and promotes JMY's actin nucleation activity and autophagosome biogenesis during autophagy (PubMed : 30420355).

Sequence similarities

Belongs to the ATG8 family.

Post-translational modifications

The precursor molecule is cleaved by ATG4 (ATG4A, ATG4B, ATG4C or ATG4D) to expose the glycine at the C-terminus and form the cytosolic form, LC3-I (PubMed:15187094, PubMed:15355958, PubMed:20818167, PubMed:29458288, PubMed:30661429, PubMed:31315929). The processed form is then activated by APG7L/ATG7, transferred to ATG3 and conjugated to phosphatidylethanolamine (PE) phospholipid to form the membrane-bound form, LC3-II (PubMed:15187094). During non-canonical autophagy, the processed form is conjugated to phosphatidylserine (PS) phospholipid (PubMed:33909989). ATG4 proteins also mediate the delipidation of PE-conjugated forms (PubMed:29458288, PubMed:33909989). In addition, ATG4B and ATG4D mediate delipidation of ATG8 proteins conjugated to PS during non-canonical autophagy (PubMed:33909989). ATG4B constitutes the major protein for proteolytic activation (PubMed:30661429). ATG4D is the main enzyme for delipidation activity (By similarity).. (Microbial infection) The Legionella effector RavZ is a deconjugating enzyme that hydrolyzes the amide bond between the C-terminal glycine residue and an adjacent aromatic residue in ATG8 proteins conjugated to phosphatidylethanolamine (PE), producing an ATG8 protein that is resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine (PubMed:23112293, PubMed:28395732, PubMed:31722778). RavZ is also able to mediate delipidation of ATG8 proteins conjugated to phosphatidylserine (PS) (PubMed:33909989).. Phosphorylation by PKA inhibits conjugation of phosphatidylethanolamine (PE) (PubMed:22948227). Interaction with MAPK15 reduces the inhibitory phosphorylation and increases autophagy activity (PubMed:22948227).. Ubiquitinated by BIRC6; this activity is inhibited by DIABLO/SMAC.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes) (PubMed : 20418806, PubMed : 23209295, PubMed : 28017329). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (PubMed : 23209295, PubMed : 28017329). In response to cellular stress and upon mitochondria fission, binds C-18 ceramides and anchors autophagolysosomes to outer mitochondrial membranes to eliminate damaged mitochondria (PubMed : 22922758). While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (PubMed : 20418806, PubMed : 23209295, PubMed : 28017329). Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway (PubMed : 24089205). Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed : 31006537, PubMed : 31006538). Upon nutrient stress, directly recruits cofactor JMY to the phagophore membrane surfaces and promotes JMY's actin nucleation activity and autophagosome biogenesis during autophagy (PubMed : 30420355).
See full target information MAP1LC3B

Publications (7)

Recent publications for all applications. Explore the full list and refine your search

Nature communications 16:1343 PubMed39905041

2025

The autophagy component LC3 regulates lymphocyte adhesion via LFA1 transport in response to outside-in signaling.

Applications

Unspecified application

Species

Unspecified reactive species

Naoyuki Kondo,Yuko Mimori-Kiyosue,Keizo Tokuhiro,Giuseppe Pezzotti,Tatsuo Kinashi

Journal of assisted reproduction and genetics 42:923-936 PubMed39810070

2025

miR-361-5p regulates SLC25A24 to maintain mitochondrial function and alleviate granulosa cell dysfunction in diminished ovarian reserve.

Applications

Unspecified application

Species

Unspecified reactive species

Jinyuan Xu,Yan Jia

EBioMedicine 106:105269 PubMed39111250

2024

A broad-spectrum multiepitope vaccine against seasonal influenza A and B viruses in mice.

Applications

Unspecified application

Species

Unspecified reactive species

Lifang Yuan,Shengze Zhang,Rongjun Bi,Xuejie Liu,Zirong Han,Minchao Li,Xinzhong Liao,Ting Xie,Shaohui Bai,Qian Xie,Chuming Luo,Ying Jiang,Jianhui Yuan,Huanle Luo,Huacheng Yan,Caijun Sun,Yuelong Shu

Autophagy 19:3062-3078 PubMed37533292

2023

AIE-enabled transfection-free identification and isolation of viable cell subpopulations differing in the level of autophagy.

Applications

Unspecified application

Species

Unspecified reactive species

Wenbin Zhang,Pengfei Wei,Liu Liu,Tao Ding,Yinyin Yang,Peipei Jin,Li Zhang,Zhibin Zhao,Meimei Wang,Bochuan Hu,Xin Jin,Zeng Xu,Han Zhang,Yang Song,Liansheng Wang,Suqin Zhong,Jing Chen,Zhenyu Yang,Ziying Chen,Yu Wu,Zhiming Ye,Youcui Xu,Yunjiao Zhang,Long-Ping Wen

GeroScience 45:3549-3560 PubMed37498479

2023

Basal autophagic flux measured in blood correlates positively with age in adults at increased risk of type 2 diabetes.

Applications

Unspecified application

Species

Unspecified reactive species

Julien Bensalem,Xiao Tong Teong,Kathryn J Hattersley,Leanne K Hein,Célia Fourrier,Kai Liu,Amy T Hutchison,Leonie K Heilbronn,Timothy J Sargeant

Developmental cell 53:141-153.e4 PubMed32275887

2020

The Dynein Adaptor RILP Controls Neuronal Autophagosome Biogenesis, Transport, and Clearance.

Applications

Unspecified application

Species

Unspecified reactive species

Noopur V Khobrekar,Sebastian Quintremil,Tiago J Dantas,Richard B Vallee

ACS nano 14:3703-3717 PubMed32057231

2020

Cell-Penetrating Nanoparticles Activate the Inflammasome to Enhance Antibody Production by Targeting Microtubule-Associated Protein 1-Light Chain 3 for Degradation.

Applications

Unspecified application

Species

Unspecified reactive species

Motao Zhu,Libo Du,Ruifang Zhao,Helen Y Wang,Yuliang Zhao,Guangjun Nie,Rong-Fu Wang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com