JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198760

Recombinant human LDL Receptor protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human LDL Receptor protein is a Human Fragment protein, in the 22 to 788 aa range, expressed in HEK 293 cells, with >87%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Low-density lipoprotein receptor, LDL receptor, LDLR

2 Images
Functional Studies - Recombinant human LDL Receptor protein (AB198760)
  • FuncS

Supplier Data

Functional Studies - Recombinant human LDL Receptor protein (AB198760)

Activity assay using ab198760 showing PCSK9-LDL Receptor interation.

SDS-PAGE - Recombinant human LDL Receptor protein (AB198760)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human LDL Receptor protein (AB198760)

4-20% SDS-PAGE analysis of 3 μg ab198760 with Coomassie staining.

LDL Receptor is heavily glycosylated, resulting in higher molecular weight. The two bands shown correspond to differing states of glycosylation.

Key facts

Purity

>87% SDS-PAGE

Expression system

HEK 293 cells

Tags

DDDDK tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Assay Conditions: 50 μL reaction mix (50 mM HEPES pH 7.4, 100 mM NaCl, 200 μM CaCl2, 0.05% Tween-20, 0.1% BSA, and up to 1500 ng PCSK9) is added to the wells coated with ab198760. Incubate for 2hr. Add antibody against polyhistidine and then incubate 1 hr. Add secondary HRP labeled antibody and incubate 30 min. Finally, add HRP chemiluminescent substrates and read luminescence.

Accession

P01130

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVRDYKDDDDK","proteinLength":"Fragment","predictedMolecularWeight":"87.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":788,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01130","tags":[{"tag":"DDDDK","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The LDL Receptor also called LDLR is a protein that plays an important role in the uptake and clearance of low-density lipoproteins (LDL) from the bloodstream. LDLR binds LDL particles facilitating their internalization through receptor-mediated endocytosis. This receptor is expressed mainly in the liver adrenal glands and other tissues involved in cholesterol metabolism. It has an approximate molecular weight of 160 kDa. Researchers often study LDLR using techniques like Western blotting to understand its presence and function.
Biological function summary

The LDL receptor interacts with LDL particles to regulate cholesterol levels in the body. It is part of a cell surface complex that recognizes and binds to apolipoprotein B-100 or apolipoprotein E present on LDL. This interaction initiates internalization of LDL leading to its degradation in lysosomes where cholesterol can be released and used by the cell. Mutations in the gene encoding LDLR can lead to inefficient cholesterol uptake influencing various metabolic processes.

Pathways

LDL receptor activities are integral to lipid metabolism and cholesterol homeostasis. Two important biological pathways that involve LDLR include the cholesterol biosynthesis pathway and the lipoprotein clearance pathway. Within these pathways LDLR collaborates closely with proteins like PCSK9 which modulates its expression and degradation and HMG-CoA reductase an important enzyme in cholesterol synthesis to balance cholesterol levels in the body.

Defects in the LDL receptor are strongly associated with familial hypercholesterolemia and atherosclerosis. These conditions arise from impaired clearance of LDL leading to elevated cholesterol levels which pose risks for cardiovascular diseases. LDLR dysfunctions are linked with the Protein PCSK9 whose gain-of-function mutations can exacerbate hypercholesterolemia by promoting degradation of LDLR while statins aim to increase LDLR expression to lower LDL cholesterol levels.

Specifications

Form

Liquid

General info

Function

Binds low density lipoprotein /LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. Forms a ternary complex with PGRMC1 and TMEM97 receptors which increases LDLR-mediated LDL internalization (PubMed : 30443021).. (Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes, but not through a direct interaction with viral proteins.. (Microbial infection) Acts as a receptor for Vesicular stomatitis virus.. (Microbial infection) In case of HIV-1 infection, may function as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells.. (Microbial infection) Acts as a receptor for Crimean-Congo hemorrhagic fever virus (CCHFV).. (Microbial infection) Acts as a receptor for many Alphavirus, including Getah virus (GETV), Ross river virus (RRV) and Semliki Forest virus.

Sequence similarities

Belongs to the LDLR family.

Post-translational modifications

N- and O-glycosylated.. Ubiquitinated by MYLIP leading to degradation.

Product protocols

Target data

Binds low density lipoprotein /LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. Forms a ternary complex with PGRMC1 and TMEM97 receptors which increases LDLR-mediated LDL internalization (PubMed : 30443021).. (Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes, but not through a direct interaction with viral proteins.. (Microbial infection) Acts as a receptor for Vesicular stomatitis virus.. (Microbial infection) In case of HIV-1 infection, may function as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells.. (Microbial infection) Acts as a receptor for Crimean-Congo hemorrhagic fever virus (CCHFV).. (Microbial infection) Acts as a receptor for many Alphavirus, including Getah virus (GETV), Ross river virus (RRV) and Semliki Forest virus.
See full target information Low-density lipoprotein receptor

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com