JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132092

Recombinant Human LEF1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LEF1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 399 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Lymphoid enhancer-binding factor 1, LEF-1, T cell-specific transcription factor 1-alpha, TCF1-alpha, LEF1

1 Images
SDS-PAGE - Recombinant Human LEF1 protein (GST tag N-Terminus) (AB132092)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human LEF1 protein (GST tag N-Terminus) (AB132092)

12.5% SDS-PAGE analysis of ab132092 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

Q9UJU2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI","proteinLength":"Full Length","predictedMolecularWeight":"69.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":399,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9UJU2","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LEF1 also known as lymphoid enhancer-binding factor 1 is a transcription factor important in the Wnt signaling pathway. It typically weighs around 44 kDa. This protein contains a high-mobility group (HMG) box domain that enables it to bind specifically to DNA and influence gene expression. LEF1 is primarily expressed in tissues with active Wnt signaling including developing organs and certain cell types like T-cells specifically Jurkat cells. Researchers use LEF1 protein immunohistochemistry (LEF1 IHC) and LEF1 markers for expression analysis in different tissues.
Biological function summary

The LEF1 transcription factor plays a significant role in cellular processes such as cell differentiation proliferation and embryonic development. As part of the Wnt signaling complex it interacts with β-catenin to regulate target gene expression. Activation of Wnt signaling by LEF1 can lead to changes in the cellular structure and function necessary for tissue development and regeneration. LEF1 also contributes to maintaining the pluripotency of stem cells by modulating gene networks critical for stem cell properties.

Pathways

The LEF1 protein is essential in Wnt/β-catenin signaling and influences the Hedgehog pathway. LEF1 pairs with β-catenin to drive the transcription of Wnt target genes involved in cell cycle and differentiation. These pathways maintain stem cell populations and regulate development. LEF1's function in these pathways links it closely to other factors like TCF7L2 and GLI family proteins which also play vital roles within these signaling cascades.

LEF1 can be linked to conditions such as cancer and immune-related diseases. Overexpression or mutation of the LEF1 protein can lead to various types of cancers including leukemia and colorectal cancer by promoting abnormal cell proliferation and survival. LEF1's role in the immune system also associates it with autoimmune diseases where dysregulation of Wnt signaling might contribute to disease progression. Altered interactions between LEF1 and β-catenin or other associated proteins can disrupt normal cellular activities leading to these pathologies.

Specifications

Form

Liquid

General info

Function

Transcription factor that binds DNA in a sequence-specific manner (PubMed : 2010090). Participates in the Wnt signaling pathway (By similarity). Activates transcription of target genes in the presence of CTNNB1 and EP300 (By similarity). PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1 (By similarity). TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1 (PubMed : 11266540). Regulates T-cell receptor alpha enhancer function (PubMed : 19653274). Required for IL17A expressing gamma-delta T-cell maturation and development, via binding to regulator loci of BLK to modulate expression (By similarity). Acts as a positive regulator of odontoblast differentiation during mesenchymal tooth germ formation, expression is repressed during the bell stage by MSX1-mediated inhibition of CTNNB1 signaling (By similarity). May play a role in hair cell differentiation and follicle morphogenesis (By similarity).. Isoform 1. Transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells.. Isoform 3. Lacks the CTNNB1 interaction domain and may therefore be an antagonist for Wnt signaling.. Isoform 5. Transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells.

Sequence similarities

Belongs to the TCF/LEF family.

Post-translational modifications

Phosphorylated at Thr-155 and/or Ser-166 by NLK. Phosphorylation by NLK at these sites represses LEF1-mediated transcriptional activation of target genes of the canonical Wnt signaling pathway.

Product protocols

Target data

Transcription factor that binds DNA in a sequence-specific manner (PubMed : 2010090). Participates in the Wnt signaling pathway (By similarity). Activates transcription of target genes in the presence of CTNNB1 and EP300 (By similarity). PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1 (By similarity). TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1 (PubMed : 11266540). Regulates T-cell receptor alpha enhancer function (PubMed : 19653274). Required for IL17A expressing gamma-delta T-cell maturation and development, via binding to regulator loci of BLK to modulate expression (By similarity). Acts as a positive regulator of odontoblast differentiation during mesenchymal tooth germ formation, expression is repressed during the bell stage by MSX1-mediated inhibition of CTNNB1 signaling (By similarity). May play a role in hair cell differentiation and follicle morphogenesis (By similarity).. Isoform 1. Transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells.. Isoform 3. Lacks the CTNNB1 interaction domain and may therefore be an antagonist for Wnt signaling.. Isoform 5. Transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells.
See full target information LEF1_HUMAN

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com