JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB287941

Recombinant Human LIF protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LIF protein (Active) is a Human Full Length protein, in the 23 to 202 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

View Alternative Names

HILDA, LIF, Leukemia inhibitory factor, Differentiation-stimulating factor, Melanoma-derived LPL inhibitor, D factor, MLPLI

5 Images
Mass Spectrometry - Recombinant Human LIF protein (Active) (AB287941)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human LIF protein (Active) (AB287941)

ESI-TOF analysis of ab287941.

Predicted MW is 19772.92 Da (+/- 10 Da by ESI-TOF). Observed MW is 19777.88 Da.

Functional Studies - Recombinant Human LIF protein (Active) (AB287941)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human LIF protein (Active) (AB287941)

Functional analysis of ab287941.

Fully biologically active determined by the dose dependent proliferation of TF-1 cells. ED50 is ≤0.16 ng/mL, corresponding to a specific activity of of 6.25 x 106 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot GR3424610-1

Functional Studies - Recombinant Human LIF protein (Active) (AB287941)
  • FuncS

Lab

Functional Studies - Recombinant Human LIF protein (Active) (AB287941)

Fully biologically active determined by dose dependent proliferation of TF-1 cells. ED50 is ≤ 0.16 ng/ml, corresponding to a specific activity of 6.25x106 units/mg. Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot. Lot GR3424610-1

HPLC - Recombinant Human LIF protein (Active) (AB287941)
  • HPLC

Supplier Data

HPLC - Recombinant Human LIF protein (Active) (AB287941)

HPLC analysis of ab287941.

SDS-PAGE - Recombinant Human LIF protein (Active) (AB287941)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human LIF protein (Active) (AB287941)

SDS-PAGE analysis of ab287941.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

HPLC, FuncS, SDS-PAGE, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of TF-1 cells. ED50 is ≤0.16 ng/mL, corresponding to a specific activity of of 6.25 x 106 units/mg.

Accession

P15018

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF","proteinLength":"Full Length","predictedMolecularWeight":"19.77 kDa","actualMolecularWeight":"19.78 kDa","aminoAcidEnd":202,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P15018","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Leukemia Inhibitory Factor (LIF) also known as LIF protein plays a critical mechanical role in cell communication and survival. It is a glycoprotein with a molecular weight (LIF MW) generally around 19 kilodaltons. In various tissues particularly in the mouse LIF expression occurs in the bone marrow muscle and notably the nervous system. Besides its presence in normal tissues it shows up in embryonic stem cells where it maintains their pluripotency in culture conditions.
Biological function summary

LIF influences cell differentiation growth and inflammatory response. As part of the interleukin-6 cytokine family LIF exerts its effects through a receptor complex involving LIFR (LIF receptor) and GP130. The LIF protein's signaling controls processes like neuronal cell differentiation and bone formation. It impacts hematopoietic cells and supports embryonic implantation and placental development by preparing the uterine environment.

Pathways

The LIF protein is essential in the JAK/STAT signaling pathway which regulates gene expression vital for survival and proliferation. It also interacts with the MAPK/ERK pathway ensuring diverse cellular responses. These pathways link LIF to related proteins like STAT3 and ERK1/2 which mediate further downstream effects. The interplay between these signaling cascades highlights LIF's role in managing cell survival and proliferation in various contexts.

LIF contributes to physiological and pathological states. In cancer such as leukemia LIF influences tumor growth and cancer cell survival. The interaction with other cytokines like Interleukin-6 enhances its effect in oncogenic processes. In inflammatory diseases like rheumatoid arthritis LIF's role relates to inflammation and joint destruction. Understanding its interaction with inflammatory mediators can aid in targeted therapeutic strategies.

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC =95%

General info

Function

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

Sequence similarities

Belongs to the LIF/OSM family.

Product protocols

Target data

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
See full target information LIF

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com