JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB283905

Recombinant Human LIGHT Protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LIGHT Protein (Active) is a Human Fragment protein, in the 74 to 240 aa range, expressed in HEK 293 cells, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, Biological Activity, HPLC, FuncS.

View Alternative Names

CD258, HVEML, LIGHT, UNQ391/PRO726, TNFSF14, Tumor necrosis factor ligand superfamily member 14, Herpes virus entry mediator ligand, HVEM-L, Herpesvirus entry mediator ligand

4 Images
Mass Spectrometry - Recombinant Human LIGHT Protein (Active) (AB283905)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant Human LIGHT Protein (Active) (AB283905)

Mass determination by ESI-TOF. Predicted MW is 18266.7 (+/- 10 Da by ESI-TOF). Observed MW is 18268.40 Da.

Biochemical assay - Recombinant Human LIGHT Protein (Active) (AB283905)
  • Biochemical assay

Supplier Data

Biochemical assay - Recombinant Human LIGHT Protein (Active) (AB283905)

Fully biologically active determined by the dose dependent proliferation of HUVEC. ED50<= 0.83 ng/ml, corresponding to a specific activity of 1.2x106 units/mg.

Cell based assay testing is performed on the first lot of the protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot : Lot GR3432040-1.

SDS-PAGE - Recombinant Human LIGHT Protein (Active) (AB283905)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human LIGHT Protein (Active) (AB283905)

SDS-PAGE analysis of ab283905.

HPLC - Recombinant Human LIGHT Protein (Active) (AB283905)
  • HPLC

Supplier Data

HPLC - Recombinant Human LIGHT Protein (Active) (AB283905)

HPLC analysis of ab 283905.

Key facts

Purity

undefined HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, Biological Activity, SDS-PAGE, HPLC, FuncS

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of HUVEC. ED50 is ≤0.83 ng/ml, corresponding to a specific activity of 1.2 x 106 units/mg.

Accession

O43557

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Biological Activity": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"" } } }

Sequence info

[{"sequence":"DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV","proteinLength":"Fragment","predictedMolecularWeight":"18.27 kDa","actualMolecularWeight":"18.27 kDa","aminoAcidEnd":240,"aminoAcidStart":74,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"O43557","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LIGHT also known as TNFSF14 is a member of the tumor necrosis factor (TNF) superfamily. It has an approximate mass of 24 kDa. You can find LIGHT expressed in various tissues including lymphoid tissues such as the spleen and lymph nodes. LIGHT serves as a ligand that can bind to receptors like lymphotoxin beta receptor (LTβR) and herpesvirus entry mediator (HVEM). Researchers have studied "mouse LIGHT" and "LIGHT protein" to understand its role in immune regulation. Additionally the term "anti-LIGHT" often refers to tools like antibodies used to investigate or inhibit LIGHT's activity.
Biological function summary

LIGHT plays a role in regulating immune responses and inflammation. It is part of a complex formed when it binds to its receptors influencing the proliferation and survival of immune cells such as T cells. LIGHT's interaction with HVEM can modulate T cell signaling cytokine production and dendritic cell maturation. It contributes to the organization of secondary lymphoid organs impacting immune surveillance and homeostasis. The presence of "APC LIGHT" indicates its involvement in antigen-presenting cell activities essential for adaptive immunity.

Pathways

LIGHT operates within the TNF receptor superfamily signaling pathway. This pathway involves other TNF members like TNF-α and lymphotoxin alfa which can also interact with LTβR. Another relevant pathway is the NF-kB signaling cascade which LIGHT activation can trigger. This cascade regulates gene expression related to immune response and cell survival. In connection to these pathways LIGHT's interaction with proteins like HVEM and LTβR helps maintain immune system balance.

LIGHT has links to autoimmune diseases and cancer. Abnormal LIGHT signaling can contribute to conditions like rheumatoid arthritis where immune cell regulation becomes dysregulated. In cancer LIGHT may play a dual role by promoting tumor immunity or conversely tumor progression depending on the context of its expression and receptor interaction. The LIGHT interaction network includes TNFRSF members and can influence pathological inflammatory responses when disrupted.

Specifications

Form

Lyophilized

Additional notes

SDS PAGE>=95% Purity

General info

Function

Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed : 10754304, PubMed : 9462508). Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production (PubMed : 10754304).

Sequence similarities

Belongs to the tumor necrosis factor family.

Post-translational modifications

N-glycosylated.. The soluble form of isoform 1 derives from the membrane form by proteolytic processing.

Product protocols

Target data

Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed : 10754304, PubMed : 9462508). Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production (PubMed : 10754304).
See full target information TNFSF14

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com