JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB180057

Recombinant Human LILRB1 protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LILRB1 protein (Fc Chimera) is a Human Fragment protein, in the 24 to 458 aa range, expressed in HEK 293 cells, with >92%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD85j, ILT2, LIR1, MIR7, LILRB1, Leukocyte immunoglobulin-like receptor subfamily B member 1, LIR-1, Leukocyte immunoglobulin-like receptor 1, CD85 antigen-like family member J, Immunoglobulin-like transcript 2, Monocyte/macrophage immunoglobulin-like receptor 7, ILT-2, MIR-7

1 Images
SDS-PAGE - Recombinant Human LILRB1 protein (Fc Chimera) (AB180057)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human LILRB1 protein (Fc Chimera) (AB180057)

Human LILRB1 (Fc Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The protein migrates as 90-105 kDa due to glycosylation.

Key facts

Purity

>92% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q8NHL6

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

Storage buffer

pH: 7.4 Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH","proteinLength":"Fragment","predictedMolecularWeight":"73.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":458,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q8NHL6","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
Up to 12 months
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle|For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA)
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LILRB1 also known as leukocyte immunoglobulin-like receptor subfamily B member 1 or CD85j is a protein expressed mainly on myeloid cells including monocytes and dendritic cells as well as some subsets of lymphocytes. This transmembrane protein is approximately 110-120 kDa in mass and is recognized for its role in immune regulation. LILRB1 interacts with MHC class I molecules on target cells mediating inhibitory signals that prevent immune overactivation. These interactions allow LILRB1 to help maintain self-tolerance and regulate adaptive immune responses.
Biological function summary

LILRB1 functions as an inhibitory receptor that dampens immune system activation by recruiting SHP-1 and SHP-2 phosphatases. As part of a complex with other immune checkpoint molecules LILRB1 modulates the balance between activating and inhibitory signals in immune cells. Its inhibitory signaling prevents excessive inflammation by reducing cytokine production and limiting T cell proliferation.

Pathways

This protein plays a role in immune signaling pathways specifically through interactions with proteins involved in the regulation of immune responses such as KIRs (Killer-cell Immunoglobulin-like Receptors). It participates in pathways that control the inhibitory signals controlling immune activity like the NK cell cytotoxicity pathway and the Fc gamma R-mediated phagocytosis pathway. Through these mechanisms LILRB1 maintains immune equilibrium and preserves tissue integrity during immune responses.

The dysregulation of LILRB1 activity links to autoimmune conditions and infectious disease outcomes. Aberrant expression or function can impact diseases such as rheumatoid arthritis and HIV influencing the progression and severity of these conditions. In rheumatoid arthritis altered LILRB1 signaling may exacerbate inflammation while in the context of HIV it could affect immune cell exhaustion. Furthermore LILRB1 interactions with proteins like ILT2 highlight its potential involvement in modulating immune responses during these diseases.

Specifications

Form

Lyophilized

General info

Function

Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G and HLA-F alleles (PubMed : 16455647, PubMed : 28636952). Receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding results in inhibitory signals and down-regulation of the immune response. Engagement of LILRB1 present on natural killer cells or T-cells by class I MHC molecules protects the target cells from lysis. Interaction with HLA-B or HLA-E leads to inhibition of FCER1A signaling and serotonin release. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions (PubMed : 11907092, PubMed : 9285411, PubMed : 9842885). Recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide (PubMed : 16455647). Upon interaction with peptide-bound HLA-G-B2M complex, triggers secretion of growth-promoting factors by decidual NK cells (PubMed : 19304799, PubMed : 29262349). Reprograms B cells toward an immune suppressive phenotype (PubMed : 24453251).

Post-translational modifications

Phosphorylated on tyrosine residues. Dephosphorylated by PTPN6.

Product protocols

Target data

Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G and HLA-F alleles (PubMed : 16455647, PubMed : 28636952). Receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding results in inhibitory signals and down-regulation of the immune response. Engagement of LILRB1 present on natural killer cells or T-cells by class I MHC molecules protects the target cells from lysis. Interaction with HLA-B or HLA-E leads to inhibition of FCER1A signaling and serotonin release. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions (PubMed : 11907092, PubMed : 9285411, PubMed : 9842885). Recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide (PubMed : 16455647). Upon interaction with peptide-bound HLA-G-B2M complex, triggers secretion of growth-promoting factors by decidual NK cells (PubMed : 19304799, PubMed : 29262349). Reprograms B cells toward an immune suppressive phenotype (PubMed : 24453251).
See full target information LILRB1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com