JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB174066

Recombinant human LIM Kinase 1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human LIM Kinase 1 protein is a Human Fragment protein, in the 285 to 638 aa range, expressed in Baculovirus infected Sf9 cells, with >95%, suitable for SDS-PAGE, WB, FuncS.

View Alternative Names

LIMK, LIMK1, LIM domain kinase 1, LIMK-1

2 Images
Functional Studies - Recombinant human LIM Kinase 1 protein (AB174066)
  • FuncS

Supplier Data

Functional Studies - Recombinant human LIM Kinase 1 protein (AB174066)

Kinase Assay demonstrating specific activity of ab174066

SDS-PAGE - Recombinant human LIM Kinase 1 protein (AB174066)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human LIM Kinase 1 protein (AB174066)

SDS-PAGE showing ab174066

Key facts

Purity

>95% Densitometry

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

FuncS, SDS-PAGE, WB

applications

Biologically active

Yes

Biological activity

The specific activity of LIMK1 was determined to be 8 nmol/min/mg.

Accession

P53667

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Kinase Assay</p>" } } }

Product details

ab85154 (Human Cofilin full length protein) and ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

Sequence info

[{"linker":null,"sequence":"GSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESG","proteinLength":"Fragment","predictedMolecularWeight":"65 kDa","actualMolecularWeight":null,"aminoAcidEnd":638,"aminoAcidStart":285,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P53667","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LIM Kinase 1 also known as LIMK1 is a serine/threonine protein kinase that plays a critical role in regulating actin cytoskeleton dynamics. Weighing approximately 72 kDa LIMK1 is expressed in various tissues with significant levels observed in the brain and spinal cord. Some studies highlight its elevated presence in neurons. The LIMK1 gene encodes the protein and its activity is often regulated through phosphorylation processes. Researchers often refer to related proteins like LIMK1/proteina in discussions about similar functions.
Biological function summary

This kinase modulates cell shape migration and differentiation by influencing actin filament networks. LIMK1 associates with regulatory complexes and interacts with several proteins to facilitate cytoskeletal reorganization. It plays an essential part in neural development and synaptic plasticity affecting learning and memory. By phosphorylating key actin-binding proteins like cofilin LIMK1 alters actin dynamics essential for various cellular functions.

Pathways

LIM Kinase 1 influences the RhoA/ROCK and Rac1/Pak pathways both critical for cytoskeletal rearrangements. Within these pathways LIMK1 interacts closely with proteins such as cofilin and is influenced by upstream activators like Rho GTPases. These pathways link it to a broader network of signaling that controls cell movement and stability important for cellular responses in various environmental contexts.

LIMK1 is linked to neurological conditions like Williams-Beuren syndrome and some forms of intellectual disability. Changes in LIMK1 expression or activity can disrupt normal brain function leading to cognitive deficits. Its connection to cofilin and other cytoskeleton-associated proteins plays a role in the pathological development of these conditions underlining its importance in maintaining normal neuronal architecture and connectivity.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways (PubMed : 10436159, PubMed : 11832213, PubMed : 12807904, PubMed : 15660133, PubMed : 16230460, PubMed : 18028908, PubMed : 22328514, PubMed : 23633677). Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop (PubMed : 10436159). LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton (PubMed : 11832213, PubMed : 15660133, PubMed : 16230460, PubMed : 23633677). In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation (PubMed : 11832213, PubMed : 15660133, PubMed : 16230460, PubMed : 23633677). Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly (PubMed : 18028908). Stimulates axonal outgrowth and may be involved in brain development (PubMed : 18028908).. Isoform 3. Has a dominant negative effect on actin cytoskeletal changes. Required for atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).

Sequence similarities

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.

Post-translational modifications

Autophosphorylated. Phosphorylated on Thr-508 by ROCK1 and PAK1, resulting in activation. Phosphorylated by PAK4 which increases the ability of LIMK1 to phosphorylate cofilin. Phosphorylated at Ser-323 by MAPKAPK2 during activation of VEGFA-induced signaling, which results in activation of LIMK1 and promotion of actin reorganization, cell migration, and tubule formation of endothelial cells. Dephosphorylated and inactivated by SSH1. Phosphorylated by CDC42BP.. Ubiquitinated. 'Lys-48'-linked polyubiquitination by RNF6 leads to proteasomal degradation through the 26S proteasome, modulating LIMK1 levels in the growth cone and its effect on axonal outgrowth. Also polyubiquitinated by RLIM (By similarity).

Product protocols

Target data

Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways (PubMed : 10436159, PubMed : 11832213, PubMed : 12807904, PubMed : 15660133, PubMed : 16230460, PubMed : 18028908, PubMed : 22328514, PubMed : 23633677). Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop (PubMed : 10436159). LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton (PubMed : 11832213, PubMed : 15660133, PubMed : 16230460, PubMed : 23633677). In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation (PubMed : 11832213, PubMed : 15660133, PubMed : 16230460, PubMed : 23633677). Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly (PubMed : 18028908). Stimulates axonal outgrowth and may be involved in brain development (PubMed : 18028908).. Isoform 3. Has a dominant negative effect on actin cytoskeletal changes. Required for atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).
See full target information LIMK1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com