JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271598

Recombinant Human Lin28A protein (DDDDK tag N-Terminus + Avi tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Lin28A protein (DDDDK tag N-Terminus + Avi tag N-Terminus) is a Human Full Length protein, in the 2 to 209 aa range, expressed in HEK 293 cells, with >70%, suitable for SDS-PAGE.

View Alternative Names

CSDD1, LIN28, ZCCHC1, LIN28A, Protein lin-28 homolog A, Lin-28A, Zinc finger CCHC domain-containing protein 1

1 Images
SDS-PAGE - Recombinant Human Lin28A protein (DDDDK tag N-Terminus + Avi tag N-Terminus) (AB271598)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Lin28A protein (DDDDK tag N-Terminus + Avi tag N-Terminus) (AB271598)

SDS-PAGE analysis of 2 μg ab271598.

Key facts

Purity

>70% SDS-PAGE

Expression system

HEK 293 cells

Tags

DDDDK tag N-Terminus Avi tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9H9Z2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN","proteinLength":"Full Length","predictedMolecularWeight":"26 kDa","actualMolecularWeight":null,"aminoAcidEnd":209,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9H9Z2","tags":[{"tag":"DDDDK","terminus":"N-Terminus"},{"tag":"Avi","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism (PubMed : 21247876). Seems to recognize a common structural G-quartet (G4) feature in its miRNA and mRNA targets (Probable). 'Translational enhancer' that drives specific mRNAs to polysomes and increases the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in mRNA stabilization. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression. Suppressor of microRNA (miRNA) biogenesis, including that of let-7, miR107, miR-143 and miR-200c. Specifically binds the miRNA precursors (pre-miRNAs), recognizing an 5'-GGAG-3' motif found in pre-miRNA terminal loop, and recruits TUT4 and TUT7 uridylyltransferases (PubMed : 18951094, PubMed : 19703396, PubMed : 22118463, PubMed : 22898984). This results in the terminal uridylation of target pre-miRNAs (PubMed : 18951094, PubMed : 19703396, PubMed : 22118463, PubMed : 22898984). Uridylated pre-miRNAs fail to be processed by Dicer and undergo degradation. The repression of let-7 expression is required for normal development and contributes to maintain the pluripotent state by preventing let-7-mediated differentiation of embryonic stem cells (PubMed : 18951094, PubMed : 19703396, PubMed : 22118463, PubMed : 22898984). Localized to the periendoplasmic reticulum area, binds to a large number of spliced mRNAs and inhibits the translation of mRNAs destined for the ER, reducing the synthesis of transmembrane proteins, ER or Golgi lumen proteins, and secretory proteins. Binds to and enhances the translation of mRNAs for several metabolic enzymes, such as PFKP, PDHA1 or SDHA, increasing glycolysis and oxidative phosphorylation. Which, with the let-7 repression may enhance tissue repair in adult tissue (By similarity).

Sequence similarities

Belongs to the lin-28 family.

Subcellular localisation

Nucleus

Product protocols

Target data

RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism (PubMed : 21247876). Seems to recognize a common structural G-quartet (G4) feature in its miRNA and mRNA targets (Probable). 'Translational enhancer' that drives specific mRNAs to polysomes and increases the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in mRNA stabilization. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression. Suppressor of microRNA (miRNA) biogenesis, including that of let-7, miR107, miR-143 and miR-200c. Specifically binds the miRNA precursors (pre-miRNAs), recognizing an 5'-GGAG-3' motif found in pre-miRNA terminal loop, and recruits TUT4 and TUT7 uridylyltransferases (PubMed : 18951094, PubMed : 19703396, PubMed : 22118463, PubMed : 22898984). This results in the terminal uridylation of target pre-miRNAs (PubMed : 18951094, PubMed : 19703396, PubMed : 22118463, PubMed : 22898984). Uridylated pre-miRNAs fail to be processed by Dicer and undergo degradation. The repression of let-7 expression is required for normal development and contributes to maintain the pluripotent state by preventing let-7-mediated differentiation of embryonic stem cells (PubMed : 18951094, PubMed : 19703396, PubMed : 22118463, PubMed : 22898984). Localized to the periendoplasmic reticulum area, binds to a large number of spliced mRNAs and inhibits the translation of mRNAs destined for the ER, reducing the synthesis of transmembrane proteins, ER or Golgi lumen proteins, and secretory proteins. Binds to and enhances the translation of mRNAs for several metabolic enzymes, such as PFKP, PDHA1 or SDHA, increasing glycolysis and oxidative phosphorylation. Which, with the let-7 repression may enhance tissue repair in adult tissue (By similarity).
See full target information LIN28A

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

International journal of molecular sciences 23: PubMed36362250

2022

Ontogenetic Changes in the Expression of the Lin28 Protein in the Rat Hypothalamic Tuberal Nuclei.

Applications

Unspecified application

Species

Unspecified reactive species

Polina A Anfimova,Lydia G Pankrasheva,Konstantin Yu Moiseev,Elizaveta S Shirina,Valentina V Porseva,Petr M Masliukov
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com