JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB137156

Recombinant Human LIN7B protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LIN7B protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 207 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

MALS2, VELI2, UNQ3116/PRO10200, LIN7B, Protein lin-7 homolog B, Lin-7B, hLin7B, Mammalian lin-seven protein 2, Vertebrate lin-7 homolog 2, MALS-2, Veli-2, hVeli2

1 Images
SDS-PAGE - Recombinant Human LIN7B protein (His tag N-Terminus) (AB137156)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human LIN7B protein (His tag N-Terminus) (AB137156)

15% SDS-PAGE analysis of ab137156 (3μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9HAP6

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 50% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl, 0.003% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQH","proteinLength":"Full Length","predictedMolecularWeight":"25.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":207,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9HAP6","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LIN7B also known as Lin-7 homolog B or MALS-2 is a multifunctional scaffolding protein that belongs to the membrane-associated guanylate kinase (MAGUK) family. The protein has a molecular mass of approximately 26 kDa. LIN7B is widely expressed in various tissues with significant presence in the brain and epithelial cells. It plays a critical role in maintaining the polarity of cells by anchoring membrane proteins to cytoskeletal elements aiding in the proper localization of these proteins at the cell membrane.
Biological function summary

LIN7B contributes to neuronal development and synaptic transmission by participating in the formation and stabilization of synaptic junctions. It forms part of the LIN7-Munc13-CASK complex which is essential for positioning glutamate receptors and modulating synaptic strength. This protein also ensures accurate signal transduction pathways by interacting with receptors ion channels and adhesion molecules facilitating efficient communication within the neural network.

Pathways

LIN7B modulates the neurotransmitter trafficking and receptor targeting within the synaptic vesicle cycle and epithelial cell polarization pathways. The protein associates with other key proteins such as CASK and DLG1 which play important roles in cell signaling and synapse formation. LIN7B's involvement in these pathways enables the regulation of excitatory signaling and cellular junctions essential for both cellular and brain function.

LIN7B has been linked to cognitive impairments and certain neurological disorders like autism spectrum disorder and schizophrenia. Abnormal expression or function of LIN7B disrupts synaptic assembly and signaling contributing to these conditions. It connects with other proteins including those in the MAGUK family where defective interactions may lead to such pathologies. LIN7B’s role in maintaining synaptic structure and function makes it a significant factor in understanding these neurological diseases.

Specifications

Form

Liquid

Additional notes

ab137156 was purified using conventional chromatography.

General info

Function

Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules (By similarity). This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells. May increase the amplitude of ASIC3 acid-evoked currents by stabilizing the channel at the cell surface (By similarity).

Sequence similarities

Belongs to the lin-7 family.

Product protocols

Target data

Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules (By similarity). This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells. May increase the amplitude of ASIC3 acid-evoked currents by stabilizing the channel at the cell surface (By similarity).
See full target information LIN7B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com