JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB137173

Recombinant Human LIN7C protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LIN7C protein is a Human Full Length protein, in the 1 to 197 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

MALS3, VELI3, LIN7C, Protein lin-7 homolog C, Lin-7C, Mammalian lin-seven protein 3, Vertebrate lin-7 homolog 3, MALS-3, Veli-3

1 Images
SDS-PAGE - Recombinant Human LIN7C protein (AB137173)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human LIN7C protein (AB137173)

15% SDS-PAGE analysis of ab137173 (3μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9NUP9

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGCSHHHHHHSSGLVPRGSHMGSMAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT","proteinLength":"Full Length","predictedMolecularWeight":"24.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":197,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NUP9","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LIN7C also known as Lin-7 homolog C or Veli3 is a protein associated with the regulation of cellular processes. This protein weighs approximately 24 kDa and is expressed in various tissues including the brain and epithelial cells. LIN7C belongs to the LIN-7 family characterized by their PDZ domains which are important for protein-protein interactions. The protein plays a significant role in maintaining cell polarity which is essential for the proper functioning of cells in different tissue types.
Biological function summary

LIN7C contributes significantly to cellular signaling and organization. It operates as part of a multiprotein complex alongside DLG1 and CASK interacting with several other proteins to facilitate cell adhesion and synaptic transmission. This assembly orchestrates the anchoring of membrane proteins influencing the spatial distribution of signaling receptors. LIN7C's role ensures that proteins reach and maintain their proper membrane location important for successful synaptic and epithelial cell functioning.

Pathways

LIN7C is actively involved in the PI3K/AKT pathway critical for cell survival and proliferation. LIN7C assists in stabilizing interactions with signaling molecules like GRIN2B contributing to synaptic plasticity and memory formation. Additionally LIN7C engages with the Wnt signaling pathway which influences cell development and differentiation through interactions with proteins such as LRP6. This interaction emphasizes LIN7C's importance in processes that guide cellular growth and differentiation.

LIN7C has connections to neurological conditions such as autism spectrum disorders and schizophrenia. Its involvement in maintaining synaptic stability and neurotransmission links it to these disorders often characterized by synaptic dysfunction. Moreover dysregulation of LIN7C affects interactions with proteins such as DLG4 contributing to the pathophysiology of these conditions. Understanding LIN7C’s role offers insight into potential therapeutic targets for mitigating synaptic-related dysfunctions seen in these neuropsychiatric disorders.

Specifications

Form

Liquid

Additional notes

ab137173 was purified using conventional chromatography techniques.

General info

Function

Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules (By similarity). This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.

Sequence similarities

Belongs to the lin-7 family.

Product protocols

Target data

Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules (By similarity). This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.
See full target information LIN7C

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com