JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB282398

Recombinant human Lipocalin-2 / NGAL protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Lipocalin-2 / NGAL protein (Active) is a Human Full Length protein, in the 21 to 198 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

View Alternative Names

HNL, NGAL, LCN2, Neutrophil gelatinase-associated lipocalin, 25 kDa alpha-2-microglobulin-related subunit of MMP-9, Lipocalin-2, Oncogene 24p3, Siderocalin, p25

4 Images
Mass Spectrometry - Recombinant human Lipocalin-2 / NGAL protein (Active) (AB282398)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human Lipocalin-2 / NGAL protein (Active) (AB282398)

Mass determination by ESI-TOF.

Predicted MW is 20604.59 Da (+/- 10 Da by ESI-TOF). Observed MW is 20606.81

Functional Studies - Recombinant human Lipocalin-2 / NGAL protein (Active) (AB282398)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Lipocalin-2 / NGAL protein (Active) (AB282398)

Fully biologically active determined by the dose dependent decrease in SH-SY5Y cell number. ED50 is ≤ 0.61 μg/ml, corresponding to a specific activity of 1.64 x 106 units/mg. Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot. Lot GR3396376-1

HPLC - Recombinant human Lipocalin-2 / NGAL protein (Active) (AB282398)
  • HPLC

Supplier Data

HPLC - Recombinant human Lipocalin-2 / NGAL protein (Active) (AB282398)

HPLC analysis of ab282398

SDS-PAGE - Recombinant human Lipocalin-2 / NGAL protein (Active) (AB282398)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Lipocalin-2 / NGAL protein (Active) (AB282398)

SDS-page analysis of ab282398

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, Mass Spec, SDS-PAGE, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent decrease in SH-SY5Y cell number.

ED50 is ≤ 0.61 μg/ml, corresponding to a specific activity of 1.64 x 106 units/mg.

Accession

P80188

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG","proteinLength":"Full Length","predictedMolecularWeight":"20.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":198,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P80188","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

General info

Function

Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development (PubMed : 12453413, PubMed : 20581821, PubMed : 27780864). Binds iron through association with 2,3-dihydroxybenzoic acid (2,3-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation : iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis (By similarity). Involved in innate immunity; limits bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin (PubMed : 27780864). Can also bind siderophores from M.tuberculosis (PubMed : 15642259, PubMed : 21978368).

Sequence similarities

Belongs to the calycin superfamily. Lipocalin family.

Product protocols

Target data

Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development (PubMed : 12453413, PubMed : 20581821, PubMed : 27780864). Binds iron through association with 2,3-dihydroxybenzoic acid (2,3-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation : iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis (By similarity). Involved in innate immunity; limits bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin (PubMed : 27780864). Can also bind siderophores from M.tuberculosis (PubMed : 15642259, PubMed : 21978368).
See full target information LCN2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com