JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB150472

Recombinant Human LITAF protein (denatured)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LITAF protein (denatured) is a Human Full Length protein, in the 1 to 161 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

PIG7, SIMPLE, LITAF, Lipopolysaccharide-induced tumor necrosis factor-alpha factor, LPS-induced TNF-alpha factor, Small integral membrane protein of lysosome/late endosome, p53-induced gene 7 protein

1 Images
SDS-PAGE - Recombinant Human LITAF protein (denatured) (AB150472)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human LITAF protein (denatured) (AB150472)

15% SDS-PAGE analysis of 3 µg of ab150472.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q99732

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as LITAF

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL","proteinLength":"Full Length","predictedMolecularWeight":"19.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":161,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q99732","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The LITAF protein also known as Lipopolysaccharide-induced TNF factor plays an important mechanical role in cellular function. It has a molecular mass of approximately 18 kDa and is prevalent in various tissues particularly within the immune system. LITAF influences the process of ubiquitination by interacting with other proteins which impacts cellular response to external stimuli. The protein contains a conserved region that facilitates interaction with ubiquitin ligases and also plays a role in the degradation of misfolded proteins.
Biological function summary

The function of LITAF extends to the regulation of inflammation. This protein acts by modulating the transcription of pro-inflammatory cytokines including TNF-alpha. As part of complexes LITAF may work in collaboration with other molecules to regulate these inflammatory responses. This regulation is vital for maintaining balance within immune responses playing a significant part in defending against hostile pathogens while avoiding excessive tissue damage caused by inflammation.

Pathways

The immune and inflammatory responses prominently feature the LITAF protein. It plays a role in the TNF signaling pathway where it helps regulate the expression of tumor necrosis factor and other inflammatory mediators. LITAF is closely related to molecules like TRAF and NF-kB within these pathways facilitating various immune functions and responses. These interactions are essential for correct signaling and action during immune challenges.

Researchers have linked LITAF to conditions such as Charcot-Marie-Tooth disease and inflammatory bowel disease. The protein's involvement with TNF-alpha links it to chronic inflammation contributing to the pathogenesis of these disorders. Studies suggest that dysregulation or mutations in LITAF may affect the normal inflammatory response further connecting with proteins such as NF-kB to exacerbate symptoms of these diseases. Understanding LITAF's role in these conditions could help in developing therapeutic strategies to manage such disorders.

Specifications

Form

Liquid

General info

Function

Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation (PubMed : 23166352). Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps down-regulate downstream signaling cascades (PubMed : 23166352). Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes (PubMed : 23166352). Probably plays a role in regulating protein degradation via its interaction with NEDD4 (PubMed : 15776429). May also contribute to the regulation of gene expression in the nucleus (PubMed : 10200294, PubMed : 15793005). Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines (PubMed : 15793005). May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10 (PubMed : 10200294, PubMed : 15793005).

Sequence similarities

Belongs to the CDIP1/LITAF family.

Post-translational modifications

Phosphorylated on tyrosine residues in response to EGF.

Subcellular localisation

Nucleus

Product protocols

Target data

Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation (PubMed : 23166352). Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps down-regulate downstream signaling cascades (PubMed : 23166352). Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes (PubMed : 23166352). Probably plays a role in regulating protein degradation via its interaction with NEDD4 (PubMed : 15776429). May also contribute to the regulation of gene expression in the nucleus (PubMed : 10200294, PubMed : 15793005). Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines (PubMed : 15793005). May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10 (PubMed : 10200294, PubMed : 15793005).
See full target information LITAF

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com