JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB307477

Recombinant Human Liver Arginase Protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Liver Arginase Protein (His tag) is a Human Full Length protein, in the 1 to 322 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for HPLC, Mass Spec, SDS-PAGE.

View Alternative Names

Arginase-1, Liver-type arginase, Type I arginase, ARG1

3 Images
Mass Spectrometry - Recombinant Human Liver Arginase Protein (His tag) (AB307477)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Liver Arginase Protein (His tag) (AB307477)

Mass determination by ESI-TOF. Predicted MW is 36243.50 Da (+/-10 Da by ESI-TOF). Observed MW is 36244.37 Da.

SDS-PAGE - Recombinant Human Liver Arginase Protein (His tag) (AB307477)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Liver Arginase Protein (His tag) (AB307477)

SDS-PAGE analysis of ab307477

HPLC - Recombinant Human Liver Arginase Protein (His tag) (AB307477)
  • HPLC

Supplier Data

HPLC - Recombinant Human Liver Arginase Protein (His tag) (AB307477)

HPLC analysis of ab307477

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

Mass Spec, SDS-PAGE, HPLC

applications

Biologically active

No

Accession

P05089

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK","proteinLength":"Full Length","predictedMolecularWeight":"36.24 kDa","actualMolecularWeight":"36.24 kDa","aminoAcidEnd":322,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P05089","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Arginase also known as arginase-1 (ARG1) and arginase-2 (ARG2) depending on the isoform is an important enzyme in the urea cycle. Its main function is to catalyze the hydrolysis of arginine to ornithine and urea. The molecular mass of arginase varies between the isoforms with ARG1 typically around 35 kDa. Arginase is expressed widely including in the liver kidneys and red blood cells for ARG1 whereas ARG2 is more tissue-specific found particularly in the kidneys brain and small intestine.
Biological function summary

Arginase plays a significant role in nitrogen metabolism and has a direct impact on ammonia detoxification. Arginase functions as a homotrimer facilitating the conversion of toxic ammonia into urea which the body excretes safely. The liver is the main site of the urea cycle and where ARG1 predominantly operates while ARG2 functions in mitochondrial roles associated with regulating arginine levels in other tissues. Additionally arginase impacts nitric oxide (NO) production as it competes with nitric oxide synthase (NOS) for their common substrate L-arginine.

Pathways

Arginase is an important component of the urea cycle and plays a part in arginine and proline metabolism. Through its function in these pathways arginase affects several physiological processes. It competes with nitric oxide synthase for L-arginine influencing NO production which is involved in vasodilation and immune response regulation. Arginase's function in the urea cycle connects it to other urea cycle enzymes like ornithine transcarbamylase (OTC) and carbamoyl phosphate synthetase I (CPS1).

Elevated arginase activity has links to certain vascular disorders such as hypertension due to reduced nitric oxide production. Arginase also plays a role in cancer as tumor cells often display increased arginase activity which depletes local arginine affecting T-cell function and aiding tumor immune evasion. These conditions often involve interactions with proteins like nitric oxide synthase which shares L-arginine as a substrate with arginase leading to potential therapeutic targets in managing these diseases.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >= 95%

General info

Function

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.. Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (PubMed : 15546957, PubMed : 16709924, PubMed : 19380772). In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival (By similarity). In humans, the immunological role in the monocytic/macrophage/dendritic cell (DC) lineage is unsure.

Sequence similarities

Belongs to the arginase family.

Product protocols

Target data

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.. Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (PubMed : 15546957, PubMed : 16709924, PubMed : 19380772). In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival (By similarity). In humans, the immunological role in the monocytic/macrophage/dendritic cell (DC) lineage is unsure.
See full target information ARG1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com