JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB163372

Recombinant Human LRRC8A protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human LRRC8A protein (GST tag N-Terminus) is a Human Fragment protein, in the 711 to 810 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

KIAA1437, LRRC8, SWELL1, UNQ221/PRO247, LRRC8A, Volume-regulated anion channel subunit LRRC8A, Leucine-rich repeat-containing protein 8A, Swelling protein 1, HsLRRC8A

1 Images
SDS-PAGE - Recombinant Human LRRC8A protein (GST tag N-Terminus) (AB163372)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human LRRC8A protein (GST tag N-Terminus) (AB163372)

ab163372 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q8IWT6

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":810,"aminoAcidStart":711,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q8IWT6","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The LRRC8A protein also known as SWELL1 plays a mechanical role as a component of the volume-regulated anion channel (VRAC). It has a molecular mass of approximately 104 kDa. The protein functions in transporting chloride ions across the plasma membrane helping to maintain cellular osmotic balance. LRRC8A is widely expressed in many tissues with high levels in the kidney heart and brain indicating its broad functional relevance across different organ systems.
Biological function summary

LRRC8A forms heteromeric complexes with related proteins LRRC8B LRRC8C LRRC8D and LRRC8E. These complexes constitute the VRAC channels which are important for regulating cell volume in response to osmotic changes a process called regulatory volume decrease. LRRC8A's involvement in this process is essential for cell survival under fluctuating environmental conditions as it prevents cellular swelling and lysis by allowing ions and osmolytes to exit the cell.

Pathways

Researchers have linked LRRC8A to the PI3K-AKT signaling pathway and the apoptotic pathway. In the context of the PI3K-AKT pathway LRRC8A contributes to cell survival and growth regulation interacting with proteins like AKT. Within the apoptotic pathway through VRAC activity LRRC8A plays a role in apoptosis regulation facilitating the release of apoptogenic factors that trigger programmed cell death when necessary.

Researchers have connected LRRC8A to conditions such as ischemia-reperfusion injury and cancer. In ischemia-reperfusion injury inadequate regulation by LRRC8A can lead to excessive cell swelling and damage upon reperfusion making it a potential therapeutic target. In cancer its role in cell growth pathways implicates LRRC8A in the uncontrolled proliferation seen in malignancies. Its association with VRAC partners like LRRC8D underpins its involvement in these disorders.

Specifications

Form

Liquid

General info

Function

Essential component of the volume-regulated anion channel (VRAC, also named VSOAC channel), an anion channel required to maintain a constant cell volume in response to extracellular or intracellular osmotic changes (PubMed : 24725410, PubMed : 24790029, PubMed : 26530471, PubMed : 26824658, PubMed : 28193731, PubMed : 29769723). The VRAC channel conducts iodide better than chloride and can also conduct organic osmolytes like taurine (PubMed : 24725410, PubMed : 24790029, PubMed : 26530471, PubMed : 26824658, PubMed : 28193731, PubMed : 30095067). Mediates efflux of amino acids, such as aspartate and glutamate, in response to osmotic stress (PubMed : 28193731). LRRC8A and LRRC8D are required for the uptake of the drug cisplatin (PubMed : 26530471). In complex with LRRC8C or LRRC8E, acts as a transporter of immunoreactive cyclic dinucleotide GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol : mediates both import and export of 2'-3'-cGAMP, thereby promoting transfer of 2'-3'-cGAMP to bystander cells (PubMed : 33171122). In contrast, complexes containing LRRC8D inhibit transport of 2'-3'-cGAMP (PubMed : 33171122). Required for in vivo channel activity, together with at least one other family member (LRRC8B, LRRC8C, LRRC8D or LRRC8E); channel characteristics depend on the precise subunit composition (PubMed : 24790029, PubMed : 26824658, PubMed : 28193731). Can form functional channels by itself (in vitro) (PubMed : 26824658). Involved in B-cell development : required for the pro-B cell to pre-B cell transition (PubMed : 14660746). Also required for T-cell development (By similarity). Required for myoblast differentiation : VRAC activity promotes membrane hyperpolarization and regulates insulin-stimulated glucose metabolism and oxygen consumption (By similarity). Also acts as a regulator of glucose-sensing in pancreatic beta cells : VRAC currents, generated in response to hypotonicity- or glucose-induced beta cell swelling, depolarize cells, thereby causing electrical excitation, leading to increase glucose sensitivity and insulin secretion (PubMed : 29371604). Also plays a role in lysosome homeostasis by forming functional lysosomal VRAC channels in response to low cytoplasmic ionic strength condition : lysosomal VRAC channels are necessary for the formation of large lysosome-derived vacuoles, which store and then expel excess water to maintain cytosolic water homeostasis (PubMed : 31270356, PubMed : 33139539).

Sequence similarities

Belongs to the LRRC8 family.

Post-translational modifications

N-glycosylated.

Subcellular localisation

Lysosome membrane

Product protocols

Target data

Essential component of the volume-regulated anion channel (VRAC, also named VSOAC channel), an anion channel required to maintain a constant cell volume in response to extracellular or intracellular osmotic changes (PubMed : 24725410, PubMed : 24790029, PubMed : 26530471, PubMed : 26824658, PubMed : 28193731, PubMed : 29769723). The VRAC channel conducts iodide better than chloride and can also conduct organic osmolytes like taurine (PubMed : 24725410, PubMed : 24790029, PubMed : 26530471, PubMed : 26824658, PubMed : 28193731, PubMed : 30095067). Mediates efflux of amino acids, such as aspartate and glutamate, in response to osmotic stress (PubMed : 28193731). LRRC8A and LRRC8D are required for the uptake of the drug cisplatin (PubMed : 26530471). In complex with LRRC8C or LRRC8E, acts as a transporter of immunoreactive cyclic dinucleotide GMP-AMP (2'-3'-cGAMP), an immune messenger produced in response to DNA virus in the cytosol : mediates both import and export of 2'-3'-cGAMP, thereby promoting transfer of 2'-3'-cGAMP to bystander cells (PubMed : 33171122). In contrast, complexes containing LRRC8D inhibit transport of 2'-3'-cGAMP (PubMed : 33171122). Required for in vivo channel activity, together with at least one other family member (LRRC8B, LRRC8C, LRRC8D or LRRC8E); channel characteristics depend on the precise subunit composition (PubMed : 24790029, PubMed : 26824658, PubMed : 28193731). Can form functional channels by itself (in vitro) (PubMed : 26824658). Involved in B-cell development : required for the pro-B cell to pre-B cell transition (PubMed : 14660746). Also required for T-cell development (By similarity). Required for myoblast differentiation : VRAC activity promotes membrane hyperpolarization and regulates insulin-stimulated glucose metabolism and oxygen consumption (By similarity). Also acts as a regulator of glucose-sensing in pancreatic beta cells : VRAC currents, generated in response to hypotonicity- or glucose-induced beta cell swelling, depolarize cells, thereby causing electrical excitation, leading to increase glucose sensitivity and insulin secretion (PubMed : 29371604). Also plays a role in lysosome homeostasis by forming functional lysosomal VRAC channels in response to low cytoplasmic ionic strength condition : lysosomal VRAC channels are necessary for the formation of large lysosome-derived vacuoles, which store and then expel excess water to maintain cytosolic water homeostasis (PubMed : 31270356, PubMed : 33139539).
See full target information LRRC8A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com