JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316075

Recombinant Human M-CSF/CSF-1 (Active) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human M-CSF/CSF-1 (Active) protein is a Human Fragment protein, in the 33 to 190 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level.

View Alternative Names

Macrophage colony-stimulating factor 1, CSF-1, M-CSF, MCSF, Lanimostim, Proteoglycan macrophage colony-stimulating factor, PG-M-CSF, CSF1

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Biologically active

Yes

Biological activity

Measured in a cell proliferation assay using RAW264.7 cells.The ED50-for this effect is 2.5 - 7.0 ng/mL.

Accession

P09603

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water.

Storage buffer

Constituents: PBS, 8% Trehalose

storage-buffer

Sequence info

[{"sequence":"EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN","proteinLength":"Fragment","predictedMolecularWeight":"20.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":190,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P09603","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage duration
A few days
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C|-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

M-CSF or macrophage colony-stimulating factor is a cytokine involved in the regulation of macrophage production. Alternative names for M-CSF include CSF-1 and colony-stimulating factor 1. The M-CSF protein has a molecular mass of approximately 18 to 22 kDa. M-CSF is mainly expressed in various tissues including the placenta kidney and bone marrow. It functions as a homodimer important for the survival proliferation and differentiation of mononuclear phagocyte lineage cells.
Biological function summary

M-CSF influences the production differentiation and function of macrophages and osteoclasts. It is not part of a large complex but interacts with its receptor the CSF1R (colony-stimulating factor 1 receptor) on the surface of target cells. This interaction promotes the survival and proliferation of the target cells playing significant roles in immune response and bone homeostasis by regulating osteoclast development.

Pathways

The interaction of M-CSF with its receptor is central to several biological pathways notably the immune system pathway and bone resorption pathway. Within these pathways the binding of M-CSF to CSF1R activates downstream signaling cascades such as the PI3K/AKT and MAPK pathways importantly affecting cell survival and differentiation. The M-CSF pathway intersects with other cytokines and factors like GM-CSF (granulocyte-macrophage colony-stimulating factor) which also regulate immune cell dynamics.

Dysregulation of M-CSF levels is implicated in conditions such as osteoporosis and certain cancers. In osteoporosis M-CSF’s role in osteoclast development links to increased bone resorption leading to bone loss. In cancers M-CSF overexpression may facilitate tumor-associated macrophage infiltration therefore supporting tumor progression. The interaction with CSF1R is significant as it serves as a potential target for therapeutic strategies aimed at modulating macrophage activity in these diseases.

Specifications

Form

Lyophilized

General info

Function

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.

Post-translational modifications

N-glycosylated.. Isoform 1. N-glycosylated.. Isoform 3. N-glycosylated.. O-glycosylated; contains chondroitin sulfate (PubMed:1531650, PubMed:8051056). O-glycosylated with core 1 or possibly core 8 glycans (PubMed:22171320, PubMed:23234360, PubMed:3264877).. Isoform 1. O-glycosylated.

Product protocols

Target data

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
See full target information CSF1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com