JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB216229

Recombinant Human Macrophage Inflammatory Protein 3 alpha (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Macrophage Inflammatory Protein 3 alpha (Fc Chimera) is a Human Full Length protein, in the 27 to 96 aa range, expressed in HEK 293 cells, with >95%, < 5 EU/mg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

LARC, MIP3A, SCYA20, CCL20, C-C motif chemokine 20, Beta-chemokine exodus-1, CC chemokine LARC, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha, Small-inducible cytokine A20, MIP-3-alpha

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 5 EU/mg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P78556

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in 50 µL of water

Storage buffer

Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM","proteinLength":"Full Length","predictedMolecularWeight":"38 kDa","actualMolecularWeight":null,"aminoAcidEnd":96,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P78556","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle|Stable for 12 months at -20°C
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Macrophage Inflammatory Protein 3 alpha (MIP-3 alpha) also known as CCL20 is a chemokine with a molecular mass of approximately 9 kDa. It plays a role in immune response by mediating chemotaxis of lymphocytes and dendritic cells. MIP-3 alpha is mainly expressed in liver lung and lymphoid organs including the lymph nodes and appendix. Its expression can be induced during inflammation in response to signaling molecules like tumor necrosis factor-alpha (TNF-alpha) and interleukin-1 beta (IL-1β).
Biological function summary

MIP-3 alpha contributes to the immune system by recruiting immune cells to sites of inflammation or injury. It is not part of a larger protein complex. Its main function is binding to the CCR6 receptor on target cells. This interaction mediates the migration and activation of the immune cells critical for initiating the immune response by increasing cell surface adhesion and motility. By drawing immune cells MIP-3 alpha significantly influences the body's capacity to fight infections and regulate inflammatory processes.

Pathways

MIP-3 alpha is integral to the inflammatory response and chemokine signaling pathways. It is involved in the immune system's adaptive response through its interaction with CCR6. This pathway overlaps with other chemokines such as MIP-1 and MIP-2 which also aid in immune cell recruitment. Furthermore MIP-3 alpha’s engagement in these pathways facilitates intercellular communication during immune responses pivotal for maintaining homeostasis and immune surveillance.

MIP-3 alpha has associations with inflammatory diseases like rheumatoid arthritis and inflammatory bowel disease. During these conditions elevated levels of MIP-3 alpha contribute to the recruitment of inflammatory cells which exacerbate symptoms. MIP-3 alpha also connects with other proteins such as TNF-alpha in these disease contexts enhancing inflammation and progression of these disorders. Targeting MIP-3 alpha and its associated pathways may provide therapeutic opportunities for alleviating these chronic inflammatory conditions.

Specifications

Form

Lyophilized

General info

Function

Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed : 11035086, PubMed : 11352563, PubMed : 20068036). The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases (PubMed : 21376174). CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes (PubMed : 11352563, PubMed : 9038201). Involved in the recruitment of both the pro-inflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells (By similarity). C-terminal processed forms have been shown to be equally chemotactically active for leukocytes (PubMed : 11035086). Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed : 23765988, PubMed : 25122636). Inhibits proliferation of myeloid progenitors in colony formation assays (PubMed : 9129037). May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells (By similarity). Possesses antibacterial activity towards E.coli ATCC 25922 and S.aureus ATCC 29213 (PubMed : 12149255).

Sequence similarities

Belongs to the intercrine beta (chemokine CC) family.

Post-translational modifications

C-terminal processed forms which lack 1, 3 or 6 amino acids are produced by proteolytic cleavage after secretion from peripheral blood monocytes.

Product protocols

Target data

Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed : 11035086, PubMed : 11352563, PubMed : 20068036). The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases (PubMed : 21376174). CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes (PubMed : 11352563, PubMed : 9038201). Involved in the recruitment of both the pro-inflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells (By similarity). C-terminal processed forms have been shown to be equally chemotactically active for leukocytes (PubMed : 11035086). Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed : 23765988, PubMed : 25122636). Inhibits proliferation of myeloid progenitors in colony formation assays (PubMed : 9129037). May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells (By similarity). Possesses antibacterial activity towards E.coli ATCC 25922 and S.aureus ATCC 29213 (PubMed : 12149255).
See full target information CCL20

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com