JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177663

Recombinant Human MCM7/PRL protein (denatured)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MCM7/PRL protein (denatured) is a Human Fragment protein, in the 1 to 414 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

CDC47, MCM2, MCM7, DNA replication licensing factor MCM7, CDC47 homolog, P1.1-MCM3

1 Images
SDS-PAGE - Recombinant Human MCM7/PRL protein (denatured) (AB177663)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human MCM7/PRL protein (denatured) (AB177663)

15% SDS-PAGE analysis of ab177663 (3 μg)

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P33993

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as MCM7

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRR","proteinLength":"Fragment","predictedMolecularWeight":"48.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":414,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P33993","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The MCM7 (Minichromosome Maintenance Complex Component 7) also known as PRL serves an important mechanical role in DNA replication. It is part of the MCM2-7 complex a helicase essential for the initiation and elongation phases of DNA replication. MCM7 has a molecular mass of approximately 81 kDa and is found expressed in the nucleus of proliferating cells. It is essential for unwinding the DNA helix preparing it for replication.
Biological function summary

MCM7 is involved in maintaining genomic stability and ensuring accurate DNA replication. As part of the larger MCM2-7 hexameric complex it collaborates with other members to form the core component of the pre-replicative complex (pre-RC). By loading onto replication origins MCM7 helps license the DNA for duplication. This function contributes to cell cycle progression particularly the S phase where DNA synthesis occurs.

Pathways

MCM7 plays an important role in DNA replication-related signaling pathways. It functions within the cell cycle and DNA replication pathways interacting closely with other essential proteins like CDC45 and GINS complex. These partnerships facilitate the transition from the G1 to the S phase triggering the replication machinery's activation and ensuring cell division processes continue smoothly.

MCM7 has been associated with various cancers including breast and prostate cancer. Aberrant expression or dysregulation of MCM7 contributes to uncontrolled cell proliferation linking it to tumorigenesis. Also MCM7 interacts with proteins such as cyclin D1 in certain oncogenic pathways emphasizing its role in the progression of cancerous conditions. Understanding these interactions offers insights into potential therapeutic targets for cancer treatment.

Specifications

Form

Liquid

General info

Function

Acts as a component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. Core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built (PubMed : 25661590, PubMed : 32453425, PubMed : 34694004, PubMed : 34700328, PubMed : 35585232, PubMed : 9305914). The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity (PubMed : 32453425). Required for S-phase checkpoint activation upon UV-induced damage.

Sequence similarities

Belongs to the MCM family.

Post-translational modifications

O-glycosylated (O-GlcNAcylated), in a cell cycle-dependent manner.. Ubiquitinated by ECS(LRR1) E3 ubiquitin-protein ligase complex when forks converge following formation of DNA interstrand cross-links. During mitosis, ubiquitinated by TRAIP when forks converge following formation of DNA interstrand cross-links (By similarity). Short ubiquitin chains on MCM7 promote recruitment of DNA glycosylase NEIL3 (By similarity). If the interstrand cross-link cannot be cleaved by NEIL3, the ubiquitin chains continue to grow on MCM7, promoting the unloading of the CMG helicase complex by the VCP/p97 ATPase (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Acts as a component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. Core component of CDC45-MCM-GINS (CMG) helicase, the molecular machine that unwinds template DNA during replication, and around which the replisome is built (PubMed : 25661590, PubMed : 32453425, PubMed : 34694004, PubMed : 34700328, PubMed : 35585232, PubMed : 9305914). The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity (PubMed : 32453425). Required for S-phase checkpoint activation upon UV-induced damage.
See full target information MCM7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com