JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB140541

Recombinant Human MCTS1/MCT-1 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MCTS1/MCT-1 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 181 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

MCT1, MCTS1, Malignant T-cell-amplified sequence 1, MCT-1, Multiple copies T-cell malignancies

1 Images
SDS-PAGE - Recombinant Human MCTS1/MCT-1 protein (His tag N-Terminus) (AB140541)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human MCTS1/MCT-1 protein (His tag N-Terminus) (AB140541)

15% SDS-PAGE analysis of ab140541 (3ug)

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9ULC4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as Malignant T cell amplified sequence 1.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK","proteinLength":"Full Length","predictedMolecularWeight":"22.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":181,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9ULC4","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MCTS1 also known as malignancy-associated gene protein MCT-1 is a protein with a molecular weight of about 18 kDa. It functions as a translation enhancer and is involved in the regulation of protein synthesis. The protein can bind to the eukaryotic translation initiation factor 3 (eIF3) and is expressed in a variety of tissues with higher expression levels often observed in tumor cells. MCTS1's role in promoting efficient translation initiation highlights its mechanistic involvement in the cellular growth process.
Biological function summary

This protein influences cell cycle progression and survival. It forms part of a complex with density-regulated protein (DENR) which aids in ribosomal recycling and the translation initiation of short upstream open reading frames. MCTS1 contributes to the modulation of cellular response to stress and is significant in processes related to cancer cell proliferation.

Pathways

The role of MCTS1 includes involvement in the mTOR and MAPK signaling pathways which regulate cell growth and survival. MCTS1 interacts with the mTOR signaling pathway and can influence translation machinery components linking it to growth-related processes. Additionally its association with eIF3 positions it within the context of translation initiation pathways where it cooperates with other proteins to fine-tune protein synthesis.

The overexpression of MCTS1 links it to cancers such as breast cancer and non-small cell lung cancer. Research indicates that MCTS1 alongside proteins like mTOR and eIF3 play a role in tumor progression and oncogenesis. The protein's involvement in translation initiation and cell growth processes suggests potential as a biomarker and target for therapeutic interventions in these malignancies.

Specifications

Form

Liquid

Additional notes

ab140541 is purified using conventional chromatography techniques.

General info

Function

Translation regulator forming a complex with DENR to promote translation reinitiation. Translation reinitiation is the process where the small ribosomal subunit remains attached to the mRNA following termination of translation of a regulatory upstream ORF (uORF), and resume scanning on the same mRNA molecule to initiate translation of a downstream ORF, usually the main ORF (mORF). The MCTS1/DENR complex is pivotal to two linked mechanisms essential for translation reinitiation. Firstly, the dissociation of deacylated tRNAs from post-termination 40S ribosomal complexes during ribosome recycling. Secondly, the recruitment in an EIF2-independent manner of aminoacylated initiator tRNA to P site of 40S ribosomes for a new round of translation (PubMed : 16982740, PubMed : 20713520, PubMed : 37875108). This regulatory mechanism governs the translation of more than 150 genes which translation reinitiation is MCTS1/DENR complex-dependent (PubMed : 16982740, PubMed : 20713520, PubMed : 37875108). Consequently, modulates various unrelated biological processes including cell cycle regulation and DNA damage signaling and repair (PubMed : 10440924, PubMed : 11709712, PubMed : 12637315, PubMed : 15897892, PubMed : 16322206, PubMed : 17016429, PubMed : 17416211, PubMed : 9766643). Notably, it positively regulates interferon gamma immunity to mycobacteria by enhancing the translation of JAK2 (PubMed : 37875108).

Sequence similarities

Belongs to the MCTS1 family.

Post-translational modifications

Phosphorylation is critical for stabilization and promotion of cell proliferation.

Product protocols

Target data

Translation regulator forming a complex with DENR to promote translation reinitiation. Translation reinitiation is the process where the small ribosomal subunit remains attached to the mRNA following termination of translation of a regulatory upstream ORF (uORF), and resume scanning on the same mRNA molecule to initiate translation of a downstream ORF, usually the main ORF (mORF). The MCTS1/DENR complex is pivotal to two linked mechanisms essential for translation reinitiation. Firstly, the dissociation of deacylated tRNAs from post-termination 40S ribosomal complexes during ribosome recycling. Secondly, the recruitment in an EIF2-independent manner of aminoacylated initiator tRNA to P site of 40S ribosomes for a new round of translation (PubMed : 16982740, PubMed : 20713520, PubMed : 37875108). This regulatory mechanism governs the translation of more than 150 genes which translation reinitiation is MCTS1/DENR complex-dependent (PubMed : 16982740, PubMed : 20713520, PubMed : 37875108). Consequently, modulates various unrelated biological processes including cell cycle regulation and DNA damage signaling and repair (PubMed : 10440924, PubMed : 11709712, PubMed : 12637315, PubMed : 15897892, PubMed : 16322206, PubMed : 17016429, PubMed : 17416211, PubMed : 9766643). Notably, it positively regulates interferon gamma immunity to mycobacteria by enhancing the translation of JAK2 (PubMed : 37875108).
See full target information MCTS1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com