JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112423

Recombinant Human MDA5 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human MDA5 protein is a Human Fragment protein, in the 928 to 1023 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

MDA5, RH116, IFIH1, Interferon-induced helicase C domain-containing protein 1, Clinically amyopathic dermatomyositis autoantigen 140 kDa, Helicase with 2 CARD domains, Interferon-induced with helicase C domain protein 1, Melanoma differentiation-associated protein 5, Murabutide down-regulated protein, RIG-I-like receptor 2, RNA helicase-DEAD box protein 116, CADM-140 autoantigen, Helicard, MDA-5, RLR-2

1 Images
SDS-PAGE - Recombinant Human MDA5 protein (AB112423)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human MDA5 protein (AB112423)

ab112423 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

Q9BYX4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"HVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSD","proteinLength":"Fragment","predictedMolecularWeight":"36.19 kDa","actualMolecularWeight":null,"aminoAcidEnd":1023,"aminoAcidStart":928,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9BYX4","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MDA5 also known as melanoma differentiation-associated protein 5 or IFIH1 is a cytosolic sensor involved in the detection of viral RNA. It is a member of the RIG-I-like receptor family and possesses a molecular weight of approximately 116 kilodaltons. MDA5 protein is expressed across various tissues but shows higher expression in the immune system's cells including macrophages and dendritic cells. MDA5 recognizes long double-stranded RNA a common viral replication byproduct triggering immune responses.
Biological function summary

In cellular defense mechanisms MDA5 plays an important role in initiating antiviral responses. It operates as part of a signaling complex that includes MAVS (mitochondrial antiviral-signaling protein) leading to the production of type I interferons and pro-inflammatory cytokines. These responses promote an antiviral state in host cells aiding in the containment and clearance of viral infections. MDA5 antibodies can be useful tools for studying these immune processes.

Pathways

MDA5 interacts with antiviral signaling pathways such as the IFN signaling pathway and the RIG-I-like receptor signaling pathway. Upon recognizing viral RNA MDA-5 cooperates with proteins like RIG-I and MAVS to activate downstream signaling cascades that mediate immune responses. This collaboration enables efficient viral recognition and response limiting viral replication and spread.

MDA5 has associations with autoimmune diseases like systemic lupus erythematosus and certain types of dermatomyositis. These conditions often involve autoantibodies against MDA5 indicating a possible role in pathogenesis. In these diseases altered function or regulation of related proteins including IFN-induced proteins may contribute to chronic inflammation and autoimmunity. Understanding MDA5's involvement in these contexts is essential for developing therapeutic strategies.

Specifications

Form

Liquid

General info

Function

Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and pro-inflammatory cytokines (PubMed : 28594402, PubMed : 32169843, PubMed : 33727702). Its ligands include mRNA lacking 2'-O-methylation at their 5' cap and long-dsRNA (>1 kb in length) (PubMed : 22160685). Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK-related kinases : TBK1 and IKBKE which phosphorylate interferon regulatory factors : IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Responsible for detecting the Picornaviridae family members such as encephalomyocarditis virus (EMCV), mengo encephalomyocarditis virus (ENMG), and rhinovirus (PubMed : 28606988). Detects coronavirus SARS-CoV-2 (PubMed : 33440148, PubMed : 33514628). Can also detect other viruses such as dengue virus (DENV), west Nile virus (WNV), and reovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome, such as vaccinia virus. Plays an important role in amplifying innate immune signaling through recognition of RNA metabolites that are produced during virus infection by ribonuclease L (RNase L). May play an important role in enhancing natural killer cell function and may be involved in growth inhibition and apoptosis in several tumor cell lines.

Sequence similarities

Belongs to the helicase family. RLR subfamily.

Post-translational modifications

Sumoylated. Sumoylation positively regulates its role in type I interferon induction and is enhanced by PIAS2-beta.. Ubiquitinated by RNF125, leading to its degradation by the proteasome (PubMed:17460044). USP17/UPS17L2-dependent deubiquitination positively regulates the receptor (PubMed:20368735). Ubiquitinated by TRIM25 via 'Lys-63'-linked ubiquitination, promoting activation of IFIH1/MDA5 (PubMed:30193849). Ubiquitinated by TRIM40 via 'Lys-48'-linked ubiquitination; leading to proteasomal degradation (PubMed:29117565). Ubiquitinated by TRIM65 via 'Lys-63'-linked ubiquitination, promoting activation of IFIH1/MDA5 (PubMed:28594402).. ISGylated by ISG15. ISGylation increases upon infection with dengue (DENV) or Zika (ZIKV) viruses. ISGylation at Lys-23 and Lys-43 is dependent of dephosphorylation at Ser-88, regulates mitochondrial translocation and oligomerization. Essential for IFIH1/MDA5-mediated cytokine responses and restriction of virus replication.. Phosphorylated at Ser-88 (PubMed:23499489, PubMed:33727702). Dephosphorylated by phosphatases PPP11CA/PPP11CC; dephosphorylation precedes and is required for ISGylation (PubMed:23499489, PubMed:33727702).. During apoptosis, processed into 3 cleavage products. The helicase-containing fragment, once liberated from the CARD domains, translocate from the cytoplasm to the nucleus. The processed protein significantly sensitizes cells to DNA degradation.. (Microbial infection) Cleaved and inactivated by the protease 2A of coxsackievirus B3, poliovirus and enterovirus 71 allowing the virus to disrupt the host type I interferon production.

Subcellular localisation

Nucleus

Product protocols

Target data

Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and pro-inflammatory cytokines (PubMed : 28594402, PubMed : 32169843, PubMed : 33727702). Its ligands include mRNA lacking 2'-O-methylation at their 5' cap and long-dsRNA (>1 kb in length) (PubMed : 22160685). Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK-related kinases : TBK1 and IKBKE which phosphorylate interferon regulatory factors : IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Responsible for detecting the Picornaviridae family members such as encephalomyocarditis virus (EMCV), mengo encephalomyocarditis virus (ENMG), and rhinovirus (PubMed : 28606988). Detects coronavirus SARS-CoV-2 (PubMed : 33440148, PubMed : 33514628). Can also detect other viruses such as dengue virus (DENV), west Nile virus (WNV), and reovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome, such as vaccinia virus. Plays an important role in amplifying innate immune signaling through recognition of RNA metabolites that are produced during virus infection by ribonuclease L (RNase L). May play an important role in enhancing natural killer cell function and may be involved in growth inhibition and apoptosis in several tumor cell lines.
See full target information IFIH1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com