JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB179957

Recombinant human MELK (mutated T460M) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human MELK (mutated T460M) protein is a Human Fragment protein, in the 1 to 550 aa range, expressed in Baculovirus infected Sf9 cells, with >80%, suitable for SDS-PAGE, FuncS.

View Alternative Names

KIAA0175, MELK, Maternal embryonic leucine zipper kinase, hMELK, Protein kinase Eg3, Protein kinase PK38, Tyrosine-protein kinase MELK, pEg3 kinase, hPK38

2 Images
Functional Studies - Recombinant human MELK (mutated T460M) protein (AB179957)
  • FuncS

Supplier Data

Functional Studies - Recombinant human MELK (mutated T460M) protein (AB179957)

Sample Kinase Activity Plot.

The specific activity of ab179957 was determined to be 120 nmol/min/mg.

SDS-PAGE - Recombinant human MELK (mutated T460M) protein (AB179957)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human MELK (mutated T460M) protein (AB179957)

SDS-PAGE analysis of ab179957.

Key facts

Purity

>80% Densitometry

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

The specific activity of ab179957 was determined to be 120 nmol/min/mg.

Accession

Q14680

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTMPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSA","proteinLength":"Fragment","predictedMolecularWeight":"88 kDa","actualMolecularWeight":null,"aminoAcidEnd":550,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q14680","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Maternal embryonic leucine zipper kinase commonly referred to as MELK is a serine/threonine protein kinase with a molecular mass of about 74 kDa. MELK is broadly expressed in both human and animal tissues with significant presence in embryonic and adult stem cells. Researchers often recognize it as MELK or MELK-0A21 in studies. The protein is characterized by its regulation of cell division and apoptosis making it an important player in cellular proliferation.
Biological function summary

MELK regulates signals that control the cell cycle apoptosis and embryonic development. MELK works as a component of complexes involved in maintaining cellular homeostasis. The protruding roles involve influencing cellular architecture and governance of stem cell maintenance. Studies in animal models show MELK involvement in maintaining pluripotency and regulation during the development phase.

Pathways

MELK participates in key processes such as the cell cycle and apoptosis pathways. Its diverse functionality connects MELK to proteins like Bcl-2-associated death promoter (BAD) and p53 which further influence main cellular events. These pathways and interactions make MELK a target of interest in the study of cellular growth and programmed cell death.

Researchers link MELK to cancer and neurodegenerative diseases. The overexpression of MELK is frequently observed in various cancer types making it relevant to oncogenesis. Studies examine its relation to proteins like cyclin-dependent kinases (CDKs) and survivin in cancer progression. Additionally MELK-0A21 variants may offer insights in disorders like Glioblastoma where abnormal MELK activity aligns with disease aggression.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.

Sequence similarities

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.

Post-translational modifications

Autophosphorylated: autophosphorylation of the T-loop at Thr-167 and Ser-171 is required for activation. Thr-478 phosphorylation during mitosis promotes interaction with PPP1R8 (Probable).

Product protocols

Target data

Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.
See full target information MELK mutated T460M

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com