JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271471

Recombinant human MERTK protein (Active) (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human MERTK protein (Active) (GST tag N-Terminus) is a Human Fragment protein, in the 578 to 872 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE, Flow Cyt, FuncS.

View Alternative Names

MER, MERTK, Tyrosine-protein kinase Mer, Proto-oncogene c-Mer, Receptor tyrosine kinase MerTK

2 Images
Functional Studies - Recombinant human MERTK protein (Active) (GST tag N-Terminus) (AB271471)
  • FuncS

Unknown

Functional Studies - Recombinant human MERTK protein (Active) (GST tag N-Terminus) (AB271471)

Specific activity of ab271471.

Specific activity ≥50 pmol/min/μg.

Assay was done in kinase buffer containing 1 mM DTT using Poly- (Glu4 : Tyr) substrate (0.2 mg/ml) and 20 μM ATP. Reaction was done at 30°C for 45 min.

SDS-PAGE - Recombinant human MERTK protein (Active) (GST tag N-Terminus) (AB271471)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human MERTK protein (Active) (GST tag N-Terminus) (AB271471)

SDS-PAGE analysis of ab271471.

Key facts

Purity

>90% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

Flow Cyt, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific activity ≥50 pmol/min/μg.

Assay was done in kinase buffer containing 1 mM DTT using Poly- (Glu4:Tyr) substrate (0.2 mg/ml) and 20 μM ATP. Reaction was done at 30°C for 45 min.

Accession

Q12866

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% Glutathione, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Flow Cyt": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EDVVIDRNLLILGKILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIY","proteinLength":"Fragment","predictedMolecularWeight":"60 kDa","actualMolecularWeight":null,"aminoAcidEnd":872,"aminoAcidStart":578,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q12866","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The MERTK protein also known as c-Mer tyrosine kinase plays a mechanical role as a receptor tyrosine kinase with a mass of approximately 110 kDa. It is expressed in multiple tissues including the retina immune cells and some epithelial cells. MERTK functions by binding with its ligands facilitating downstream signaling that affects cellular functions. The receptor is part of the TAM family alongside proteins like AXL and TYRO3.
Biological function summary

The receptor MERTK orchestrates processes critical for maintaining cellular homeostasis such as efferocytosis and immune response regulation. It does not operate alone but often interacts with other cellular components to form functional complexes. This protein contributes significantly to phagocytosis a cellular process for clearing apoptotic cells ensuring a controlled immune environment.

Pathways

Several signal transduction pathways involve c-Mer tyrosine kinase in maintaining cellular communication. Notably it participates in the RAS/MAPK and PI3K/AKT pathways which are essential for cell survival and proliferation. These pathways involve interactions with proteins such as GAB1 and SOS highlighting the receptor's integration in cell signaling networks.

Aberrant activity of MERTK has associations with cancer and autoimmune disorders. In cancers such as leukemia overexpression of the MERTK protein promotes cell survival and proliferation. Its interaction with other proteins like GRB2 can further exacerbate oncogenic pathways. In autoimmune diseases dysregulated MERTK expression can lead to improper clearance of apoptotic cells contributing to systemic inflammation.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including LGALS3, TUB, TULP1 or GAS6. Regulates many physiological processes including cell survival, migration, differentiation, and phagocytosis of apoptotic cells (efferocytosis). Ligand binding at the cell surface induces autophosphorylation of MERTK on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment (PubMed : 32640697). Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Also plays an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. AXL/UFO subfamily.

Post-translational modifications

Autophosphorylated on Tyr-749, Tyr-753 and Tyr-754 in the activation loop allowing full activity. Autophosphorylated on Tyr-872 leading to recruitment of downstream partners of the signaling cascade such as PLCG2 (By similarity).

Product protocols

Target data

Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including LGALS3, TUB, TULP1 or GAS6. Regulates many physiological processes including cell survival, migration, differentiation, and phagocytosis of apoptotic cells (efferocytosis). Ligand binding at the cell surface induces autophosphorylation of MERTK on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment (PubMed : 32640697). Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Also plays an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.
See full target information MERTK

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com