JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB103495

Recombinant Human METTL1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human METTL1 protein is a Human Full Length protein, in the 1 to 276 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C12orf1, METTL1, tRNA (guanine-N(7)-)-methyltransferase, Methyltransferase-like protein 1, mRNA (guanine-N(7)-)-methyltransferase, miRNA (guanine-N(7)-)-methyltransferase, tRNA (guanine(46)-N(7))-methyltransferase, tRNA(m7G46)-methyltransferase

1 Images
SDS-PAGE - Recombinant Human METTL1 protein (AB103495)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human METTL1 protein (AB103495)

SDS-PAGE of ab103495 (3µg) under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q9UBP6

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.29% Sodium chloride, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH","proteinLength":"Full Length","predictedMolecularWeight":"33.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":276,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UBP6","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

METTL1 also known as Methyltransferase-Like 1 is an enzyme responsible for catalyzing the methylation of specific substrates. This protein has a molecular mass of approximately 50 kDa. METTL1 is expressed across various tissues but shows higher expression levels in the brain and testes. Its enzymatic activity involves transferring a methyl group through its interaction with S-adenosylmethionine (SAM) to form N7-methylguanosine (m7G) on tRNA molecules which is essential for regulating their stability and function.
Biological function summary

METTL1 is important in modulating the processes of cellular growth and differentiation. METTL1 forms a complex with WDR4 which assists its function in tRNA modification. This complex is necessary for the precise modification of tRNA ensuring accurate protein synthesis and cellular homeostasis. Investigations reveal METTL1's role in cellular processes such as proliferation and stem cell maintenance highlighting its functional importance in cell cycle control and organismal development.

Pathways

METTL1 integrates into significant molecular pathways like mRNA translation and tRNA processing. METTL1 associates with proteins like SAM and FTO within these pathways. The enzyme influences the mTOR signaling pathway which plays a major role in regulating cellular growth and metabolism. Through its methyltransferase activity METTL1 impacts the proper functioning of ribosomes and protein synthesis linking it to the translational control of gene expression.

Research links METTL1 to various cancers including glioblastoma and lung cancer. Aberrant METTL1 expression or activity correlates with tumor progression and malignancy due to its role in altered protein synthesis. METTL1 dysregulation also relates to intellectual disabilities highlighting its importance in brain function. In the context of cancer proteins like mTOR and MYC have been connected to METTL1 by affecting pathways which influence tumor cell survival and proliferation.

Specifications

Form

Liquid

Additional notes

ab103495 was purified using conventional chromatography techniques.

General info

Function

Catalytic component of METTL1-WDR4 methyltransferase complex that mediates the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed : 12403464, PubMed : 31031083, PubMed : 31031084, PubMed : 36599982, PubMed : 36599985, PubMed : 37369656, PubMed : 37379838). Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in a large subset of tRNAs that contain the 5'-RAGGU-3' motif within the variable loop (PubMed : 12403464, PubMed : 34352206, PubMed : 34352207, PubMed : 36599982, PubMed : 36599985, PubMed : 37369656). M7G46 interacts with C13-G22 in the D-loop to stabilize tRNA tertiary structure and protect tRNAs from decay (PubMed : 36599982, PubMed : 36599985). Also acts as a methyltransferase for a subset of internal N(7)-methylguanine in mRNAs (PubMed : 31031084, PubMed : 37379838). Internal N(7)-methylguanine methylation of mRNAs in response to stress promotes their relocalization to stress granules, thereby suppressing their translation (PubMed : 31031084, PubMed : 37379838). Also methylates a specific subset of miRNAs, such as let-7 (PubMed : 31031083). N(7)-methylguanine methylation of let-7 miRNA promotes let-7 miRNA processing by disrupting an inhibitory secondary structure within the primary miRNA transcript (pri-miRNA) (PubMed : 31031083). Acts as a regulator of embryonic stem cell self-renewal and differentiation (By similarity).

Sequence similarities

Belongs to the class I-like SAM-binding methyltransferase superfamily. TrmB family.

Post-translational modifications

Phosphorylation at Ser-27 by PKB/AKT1 inactivates its methyltransferase activity via a steric interference mechanism in the active site that locally disrupts the catalytic center (PubMed:15861136, PubMed:36599985). Phosphorylation at Ser-27 does not affect the interaction with WDR4 (PubMed:15861136).

Subcellular localisation

Nucleus

Product protocols

Target data

Catalytic component of METTL1-WDR4 methyltransferase complex that mediates the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed : 12403464, PubMed : 31031083, PubMed : 31031084, PubMed : 36599982, PubMed : 36599985, PubMed : 37369656, PubMed : 37379838). Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in a large subset of tRNAs that contain the 5'-RAGGU-3' motif within the variable loop (PubMed : 12403464, PubMed : 34352206, PubMed : 34352207, PubMed : 36599982, PubMed : 36599985, PubMed : 37369656). M7G46 interacts with C13-G22 in the D-loop to stabilize tRNA tertiary structure and protect tRNAs from decay (PubMed : 36599982, PubMed : 36599985). Also acts as a methyltransferase for a subset of internal N(7)-methylguanine in mRNAs (PubMed : 31031084, PubMed : 37379838). Internal N(7)-methylguanine methylation of mRNAs in response to stress promotes their relocalization to stress granules, thereby suppressing their translation (PubMed : 31031084, PubMed : 37379838). Also methylates a specific subset of miRNAs, such as let-7 (PubMed : 31031083). N(7)-methylguanine methylation of let-7 miRNA promotes let-7 miRNA processing by disrupting an inhibitory secondary structure within the primary miRNA transcript (pri-miRNA) (PubMed : 31031083). Acts as a regulator of embryonic stem cell self-renewal and differentiation (By similarity).
See full target information METTL1 phospho S27

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com