JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB268789

Recombinant human METTL3 + METTL14 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human METTL3 + METTL14 protein (Active) is a Human Full Length protein, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE, FuncS.

View Alternative Names

MTA70, METTL3, N(6)-adenosine-methyltransferase catalytic subunit METTL3, Methyltransferase-like protein 3, N(6)-adenosine-methyltransferase 70 kDa subunit, hMETTL3, MT-A70

2 Images
Functional Studies - Recombinant human METTL3 + METTL14 protein (Active) (AB268789)
  • FuncS

Supplier Data

Functional Studies - Recombinant human METTL3 + METTL14 protein (Active) (AB268789)

The specific activity of ab268789 was 750 pmol/min/mg in an in vitro assay using an oligo ssRNA substrate.

SDS-PAGE - Recombinant human METTL3 + METTL14 protein (Active) (AB268789)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human METTL3 + METTL14 protein (Active) (AB268789)

SDS-PAGE analysis of ab268789.

Key facts

Purity

>90% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

The specific activity of ab268789 was 750 pmol/min/mg in an in vitro assay using an oligo ssRNA substrate.

Accession

Q86U44

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Proteins co-expressed

Sequence info

[{"sequence":"","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q86U44","tags":[{"tag":"GST","terminus":"N-Terminus"}]},{"sequence":"MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":456,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q9HCE5","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

METTL3 and METTL14 are important players in RNA methylation specifically involved in N6-methyladenosine (m6A) modification. METTL3 often referred to as methyltransferase-like 3 has a molecular weight of approximately 70 kDa and frequently forms a complex with METTL14 in cells. The METTL3 protein is mainly expressed in the nucleus where it orchestrates the process of adding a methyl group to adenosine residues on RNA transcripts. This activity modifies mRNA molecules influencing their stability and translation efficiency.
Biological function summary

METTL3 and METTL14 function together as the core components of the m6A methyltransferase complex which also includes associated proteins like WTAP. This complex plays a significant role in gene expression and RNA metabolism. METTL3 and METTL14 regulate mRNA splicing nuclear export and degradation by acting on specific consensus sequences. Recognition of these sequences allows for the modulation of various RNA biological processes impacting cellular response and development.

Pathways

METTL3 and METTL14 play key roles in the m6A RNA methylation pathway influencing signaling pathways such as the mTOR and Wnt pathways. These pathways are vital for regulating cell proliferation and differentiation. Additionally METTL3 interacts with proteins like YTHDF1 which act as m6A readers and help mediate the effects of methylated RNA on biological outcomes creating a link between m6A marks and the functional response within the cell.

METTL3 and METTL14 have shown associations with certain cancers and neurological disorders. In various cancers such as acute myeloid leukemia upregulated METTL3 levels correlate with increased malignancy and poor prognosis. In neurological contexts altered m6A modification patterns from METTL3 and METTL14 activity may connect to proteins like FTO which has implications in neurodevelopmental disorders. Therefore understanding their roles in these conditions offers potential therapeutic avenues.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues at the N(6) position of some RNAs and regulates various processes such as the circadian clock, differentiation of embryonic and hematopoietic stem cells, cortical neurogenesis, response to DNA damage, differentiation of T-cells and primary miRNA processing (PubMed : 22575960, PubMed : 24284625, PubMed : 25719671, PubMed : 25799998, PubMed : 26321680, PubMed : 26593424, PubMed : 27281194, PubMed : 27373337, PubMed : 27627798, PubMed : 28297716, PubMed : 29348140, PubMed : 29506078, PubMed : 30428350, PubMed : 9409616). In the heterodimer formed with METTL14, METTL3 constitutes the catalytic core (PubMed : 27281194, PubMed : 27373337, PubMed : 27627798). N6-methyladenosine (m6A), which takes place at the 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role in mRNA stability, processing, translation efficiency and editing (PubMed : 22575960, PubMed : 24284625, PubMed : 25719671, PubMed : 25799998, PubMed : 26321680, PubMed : 26593424, PubMed : 28297716, PubMed : 9409616). M6A acts as a key regulator of mRNA stability : methylation is completed upon the release of mRNA into the nucleoplasm and promotes mRNA destabilization and degradation (PubMed : 28637692). In embryonic stem cells (ESCs), m6A methylation of mRNAs encoding key naive pluripotency-promoting transcripts results in transcript destabilization, promoting differentiation of ESCs (By similarity). M6A regulates the length of the circadian clock : acts as an early pace-setter in the circadian loop by putting mRNA production on a fast-track for facilitating nuclear processing, thereby providing an early point of control in setting the dynamics of the feedback loop (By similarity). M6A also regulates circadian regulation of hepatic lipid metabolism (PubMed : 30428350). M6A regulates spermatogonial differentiation and meiosis and is essential for male fertility and spermatogenesis (By similarity). Also required for oogenesis (By similarity). Involved in the response to DNA damage : in response to ultraviolet irradiation, METTL3 rapidly catalyzes the formation of m6A on poly(A) transcripts at DNA damage sites, leading to the recruitment of POLK to DNA damage sites (PubMed : 28297716). M6A is also required for T-cell homeostasis and differentiation : m6A methylation of transcripts of SOCS family members (SOCS1, SOCS3 and CISH) in naive T-cells promotes mRNA destabilization and degradation, promoting T-cell differentiation (By similarity). Inhibits the type I interferon response by mediating m6A methylation of IFNB (PubMed : 30559377). M6A also takes place in other RNA molecules, such as primary miRNA (pri-miRNAs) (PubMed : 25799998). Mediates m6A methylation of Xist RNA, thereby participating in random X inactivation : m6A methylation of Xist leads to target YTHDC1 reader on Xist and promote transcription repression activity of Xist (PubMed : 27602518). M6A also regulates cortical neurogenesis : m6A methylation of transcripts related to transcription factors, neural stem cells, the cell cycle and neuronal differentiation during brain development promotes their destabilization and decay, promoting differentiation of radial glial cells (By similarity). METTL3 mediates methylation of pri-miRNAs, marking them for recognition and processing by DGCR8 (PubMed : 25799998). Acts as a positive regulator of mRNA translation independently of the methyltransferase activity : promotes translation by interacting with the translation initiation machinery in the cytoplasm (PubMed : 27117702). Its overexpression in a number of cancer cells suggests that it may participate in cancer cell proliferation by promoting mRNA translation (PubMed : 27117702). During human coronavirus SARS-CoV-2 infection, adds m6A modifications in SARS-CoV-2 RNA leading to decreased RIGI binding and subsequently dampening the sensing and activation of innate immune responses (PubMed : 33961823).

Sequence similarities

Belongs to the MT-A70-like family.

Post-translational modifications

Sumoylation inhibits the N6-adenosine-methyltransferase activity. Sumoylation does not affect subcellular location or interaction with METTL14. Desumoylated by SENP1.

Subcellular localisation

Nucleus

Product protocols

Target data

The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues at the N(6) position of some RNAs and regulates various processes such as the circadian clock, differentiation of embryonic and hematopoietic stem cells, cortical neurogenesis, response to DNA damage, differentiation of T-cells and primary miRNA processing (PubMed : 22575960, PubMed : 24284625, PubMed : 25719671, PubMed : 25799998, PubMed : 26321680, PubMed : 26593424, PubMed : 27281194, PubMed : 27373337, PubMed : 27627798, PubMed : 28297716, PubMed : 29348140, PubMed : 29506078, PubMed : 30428350, PubMed : 9409616). In the heterodimer formed with METTL14, METTL3 constitutes the catalytic core (PubMed : 27281194, PubMed : 27373337, PubMed : 27627798). N6-methyladenosine (m6A), which takes place at the 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role in mRNA stability, processing, translation efficiency and editing (PubMed : 22575960, PubMed : 24284625, PubMed : 25719671, PubMed : 25799998, PubMed : 26321680, PubMed : 26593424, PubMed : 28297716, PubMed : 9409616). M6A acts as a key regulator of mRNA stability : methylation is completed upon the release of mRNA into the nucleoplasm and promotes mRNA destabilization and degradation (PubMed : 28637692). In embryonic stem cells (ESCs), m6A methylation of mRNAs encoding key naive pluripotency-promoting transcripts results in transcript destabilization, promoting differentiation of ESCs (By similarity). M6A regulates the length of the circadian clock : acts as an early pace-setter in the circadian loop by putting mRNA production on a fast-track for facilitating nuclear processing, thereby providing an early point of control in setting the dynamics of the feedback loop (By similarity). M6A also regulates circadian regulation of hepatic lipid metabolism (PubMed : 30428350). M6A regulates spermatogonial differentiation and meiosis and is essential for male fertility and spermatogenesis (By similarity). Also required for oogenesis (By similarity). Involved in the response to DNA damage : in response to ultraviolet irradiation, METTL3 rapidly catalyzes the formation of m6A on poly(A) transcripts at DNA damage sites, leading to the recruitment of POLK to DNA damage sites (PubMed : 28297716). M6A is also required for T-cell homeostasis and differentiation : m6A methylation of transcripts of SOCS family members (SOCS1, SOCS3 and CISH) in naive T-cells promotes mRNA destabilization and degradation, promoting T-cell differentiation (By similarity). Inhibits the type I interferon response by mediating m6A methylation of IFNB (PubMed : 30559377). M6A also takes place in other RNA molecules, such as primary miRNA (pri-miRNAs) (PubMed : 25799998). Mediates m6A methylation of Xist RNA, thereby participating in random X inactivation : m6A methylation of Xist leads to target YTHDC1 reader on Xist and promote transcription repression activity of Xist (PubMed : 27602518). M6A also regulates cortical neurogenesis : m6A methylation of transcripts related to transcription factors, neural stem cells, the cell cycle and neuronal differentiation during brain development promotes their destabilization and decay, promoting differentiation of radial glial cells (By similarity). METTL3 mediates methylation of pri-miRNAs, marking them for recognition and processing by DGCR8 (PubMed : 25799998). Acts as a positive regulator of mRNA translation independently of the methyltransferase activity : promotes translation by interacting with the translation initiation machinery in the cytoplasm (PubMed : 27117702). Its overexpression in a number of cancer cells suggests that it may participate in cancer cell proliferation by promoting mRNA translation (PubMed : 27117702). During human coronavirus SARS-CoV-2 infection, adds m6A modifications in SARS-CoV-2 RNA leading to decreased RIGI binding and subsequently dampening the sensing and activation of innate immune responses (PubMed : 33961823).
See full target information METTL3

Additional targets

METTL14

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com