JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114707

Recombinant Human mGluR1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human mGluR1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 387 to 486 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

GPRC1A, MGLUR1, GRM1, Metabotropic glutamate receptor 1, mGluR1

1 Images
SDS-PAGE - Recombinant Human mGluR1 protein (GST tag N-Terminus) (AB114707)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human mGluR1 protein (GST tag N-Terminus) (AB114707)

12.5% SDS-PAGE showing ab114707 at approximately 36.63 kDa stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

Q13255

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein).</p>" } } }

Product details

This product was previously labelled as Metabotropic Glutamate Receptor 1, Metabotropic Glutamate Receptor 1a.

Sequence info

[{"sequence":"NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":486,"aminoAcidStart":387,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13255","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The mGluR1 also known as metabotropic glutamate receptor 1 is a protein that plays an important mechanical role in the central nervous system. It belongs to the G-protein coupled receptor (GPCR) family and serves as a receptor for the neurotransmitter glutamate. The protein has a mass of approximately 132 kDa. It is expressed mainly in the brain particularly in the cerebellum hippocampus and cortex. In these regions mGluR1 is involved in mediating excitatory neurotransmission by modulating ion channels and intracellular signaling pathways.
Biological function summary

MGluR1 contributes to synaptic plasticity a critical process for learning and memory. It forms part of a signaling complex that interacts with several other proteins including Homer proteins which facilitate the link to intracellular calcium release channels. The receptor's activation leads to a cascade of intracellular events including the mobilization of calcium and activation of various kinases. These processes subsequently affect long-term potentiation and depression which are key for adaptable and responsive neural circuits.

Pathways

MGluR1 operates within important signaling pathways such as the phosphoinositide pathway and the MAPK/ERK pathway. In the phosphoinositide pathway it activates phospholipase C which results in the production of inositol trisphosphate and diacylglycerol second messengers that regulate calcium release and protein kinase C activation respectively. Within the MAPK/ERK pathway mGluR1 activation contributes to gene expression changes through ERK activation influencing cellular responses and adaptations. Proteins such as calcium-calmodulin and GRK2 are related to mGluR1 within these pathways impacting receptor sensitivity and function.

MGluR1 plays a role in neurodegenerative disorders like Alzheimer's disease and movement disorders such as spinocerebellar ataxia. In Alzheimer’s disease dysregulation of glutamate signaling involving mGluR1 can contribute to synaptic dysfunction and the progression of neurodegeneration. Spinocerebellar ataxia involves alterations in motor coordination linked to mGluR1 function in the cerebellum. Additionally mGluR1 has associations with proteins such as NMDA receptors in Alzheimer's where altered signaling can exacerbate disease symptoms and progression through excitotoxic pathways.

Specifications

Form

Liquid

General info

Function

G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system. May participate in the central action of glutamate in the CNS, such as long-term potentiation in the hippocampus and long-term depression in the cerebellum (PubMed : 24603153, PubMed : 28886343, PubMed : 7476890). May function in the light response in the retina (By similarity). Induces GRID1 and GRID2 cation-channel activation via GNAQ-PLC-PKC pathway in dopaminergic neurons and cerebellar Purkinje cell, respectively (PubMed : 24357660, PubMed : 27276689).

Sequence similarities

Belongs to the G-protein coupled receptor 3 family.

Product protocols

Target data

G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system. May participate in the central action of glutamate in the CNS, such as long-term potentiation in the hippocampus and long-term depression in the cerebellum (PubMed : 24603153, PubMed : 28886343, PubMed : 7476890). May function in the light response in the retina (By similarity). Induces GRID1 and GRID2 cation-channel activation via GNAQ-PLC-PKC pathway in dopaminergic neurons and cerebellar Purkinje cell, respectively (PubMed : 24357660, PubMed : 27276689).
See full target information GRM1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com